UniGene Name: sp_v3.0_unigene51222
Length: 219 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene51222
T |
Ace file of the UniGene sp_v3.0_unigene51222 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 716B2 n=2 Tax=Picea sitchensis RepID=C16B2_PICSI | - | - | 1.0e-33 | 90% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Cytochrome P450 | - | - | 6.374e-18 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Taxane 13-alpha-hydroxylase. | EC:1.14.13.77 | - | 1.05e-25 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 1.05e-25 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.05e-25 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.05e-25 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.05e-25 | % |
| Source | Gene names |
|---|---|
| Sma3 | 10bh; At3g19270; At5g36110; At5g36130; CYP707A4; CYP716A11P; CYP716A12; CYP716A3; CYP716A6; CYP716A8; CYP716A9; CYP716B1; CYP716B2; CYP716B3; CYP716B4; CYP716C1; CYP716C2v1; CYP716C2v2; CYP716D1; CYP716D2v1|CYP716D3v1; CYP725A1; CYP725A2; GSVIVT0000899000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | (+)-abscisic acid 8'-hydroxylase activity | GO:0010295 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Hemocyanin, copper-type | IPR000896 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Cytochrome P450, B-class | IPR002397 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G36130.1 | Cytochrome P450 superfamily protein chr5:14209293-14209811 REVERSE LENGTH=140 | 2.0e-31 | 64% |
| RefSeq | Arabidopsis thaliana | NP_198462.1 | Cytochrome P450 family protein [Arabidopsis thaliana] | 2.0e-31 | 64% |
| RefSeq | Populus trichocarpa | XP_002309057.1 | cytochrome P450 [Populus trichocarpa] | 6.0e-35 | 73% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P257
Fln msg: STOP codon was not found. Distance to subject end: 4 aas, your sequence is shorter than subject: 72 - 327
Fln protein:
D
Protein Length:
73
Fln nts:
T
Fln Alignment:
CL22689Contig1___DPSRFEGNGPPPYTFVPFGGGPRMCPGNEFARMEILVFVHNIVKAFKWSLVNPGEKVIVDPMPEPVNGLPIK
A9P257_______________DPSRFEGAGPPPYTFVPFGGGPRMCPGNEFARMEILVFLHNIVKNFRWSLVNPGEKVIVDPMPVPVNGMPIK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)