|
||||||
|
UniGene Name: sp_v3.0_unigene51091
Length: 131 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene51091
G |
|
Ace file of the UniGene sp_v3.0_unigene51091
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pfam00010, HLH, Helix-loop-helix DNA-binding domain | - | - | 3.0e-07 | 38% |
| FL-Next | sp=Transcription factor bHLH66; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 90% |
| Sma3 | BHLH transcription factor | - | - | 1.78e-20 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G68920; AT2G43010; AT4G02590; At1g03040; At1g10120; At1g26260; At1g59640; At1g68920; At2g18300; At2g24260; At2g43010; At3g07340; At3g23690; At4g02590; At4g30980; At4g34530; At5g48560; At5g50915; At5g58010; BHLH137; BHLH31; BHLH49; BHLH59; BHLH62; BHLH6 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | transcription regulator activity | GO:0030528 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein modification process | GO:0006464 | Biological Process | 0.0 | - |
| Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
| Sma3 | double fertilization forming a zygote and endosperm | GO:0009567 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | de-etiolation | GO:0009704 | Biological Process | 0.0 | - |
| Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
| Sma3 | red light signaling pathway | GO:0010161 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | petal morphogenesis | GO:0048446 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histone H3 | IPR000164 | - | 0.0 | - |
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Ubiquitin | IPR000626 | - | 0.0 | - |
| Sma3 | IPR001092 | - | 0.0 | - | |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase, subunit 2, domain 6 | IPR007120 | - | 0.0 | - |
| Sma3 | Histone core | IPR007125 | - | 0.0 | - |
| Sma3 | Histone-fold | IPR009072 | - | 0.0 | - |
| Sma3 | Helix-loop-helix DNA-binding | IPR011598 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, OB-fold | IPR014724 | - | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase, subunit 2 | IPR015712 | - | 0.0 | - |
| Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9ZUG9
Fln msg: Distance to subject end: 164 aas, your sequence is shorter than subject: 43 - 350
Fln protein:
Q
Protein Length:
44
Fln nts:
G
Fln Alignment:
CL20992Contig1___QATDPHSXXXXXXXXXXXXXMKALQELVPNCSKTDKAAMLDEI
Q9ZUG9_______________QATDPHSIAERLRRERIAERMKALQELVPNGNKTDKASMLDEI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
