|
||||||
|
UniGene Name: sp_v3.0_unigene50893
Length: 181 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene50893
G |
|
Ace file of the UniGene sp_v3.0_unigene50893
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | dicer-like protein [Oryza sativa Indica Group] | - | - | 8.0e-14 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
| Sma3 | Dicer-like protein | - | - | 4.387e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribonuclease III. | EC:3.1.26.3 | - | 4.358e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g01040; At3g03300; At3g43920; CAF; DCL1504; DCL1a; DCL1b; DCL901; DCL902; DCL903; DCL904; GSVIVT00005618001; GSVIVT00025032001; GSVIVT00026189001; GSVIVT00032302001; LOC_Os03g02970; LOC_Os10g34430; MtrDRAFT_AC150443g32v2; OJ1705B08.11; OSJNBa0029C15.23 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | nuclear dicing body | GO:0010445 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
| Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
| Sma3 | ribonuclease III activity | GO:0004525 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | cytokinesis | GO:0000910 | Biological Process | 0.0 | - |
| Sma3 | RNA processing | GO:0006396 | Biological Process | 0.0 | - |
| Sma3 | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | - |
| Sma3 | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | maintenance of DNA methylation | GO:0010216 | Biological Process | 0.0 | - |
| Sma3 | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | - |
| Sma3 | production of ta-siRNAs involved in RNA interference | GO:0010267 | Biological Process | 0.0 | - |
| Sma3 | production of lsiRNA involved in RNA interference | GO:0010599 | Biological Process | 0.0 | - |
| Sma3 | primary miRNA processing | GO:0031053 | Biological Process | 0.0 | - |
| Sma3 | mRNA cleavage involved in gene silencing by miRNA | GO:0035279 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G01040.2 | DCL1 dicer-like 1 chr1:23519-31079 FORWARD LENGTH=1910 | 5.0e-18 | 69% |
| RefSeq | Arabidopsis thaliana | NP_171612.1 | endoribonuclease Dicer [Arabidopsis thaliana] | 7.0e-18 | 69% |
| RefSeq | Populus trichocarpa | XP_002315119.1 | dicer-like protein [Populus trichocarpa] | 9.0e-19 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW09
Fln msg: Distance to subject end: 165 aas, your sequence is shorter than subject: 60 - 330
Fln protein:
A
Protein Length:
61
Fln nts:
G
Fln Alignment:
CL18498Contig1___ASQQDPEGGCCYQRLEFLGDSVLDFLITQHLYSMHSGLSPGFLTDLRSAAVNNENFARAA
A9NW09_______________ASYKEPSFSGCYQRLEFLGDAVLDYLITLYFYKTYPGLSPGLLTDLRSAAVNNDCYAQAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
