UniGene Name: sp_v3.0_unigene50839
Length: 179 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene50839
T |
Ace file of the UniGene sp_v3.0_unigene50839
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative ripening-related P-450 enzyme n=3 Tax=Vitis vinifera RepID=Q9M4G8_VITVI | - | - | 7.0e-20 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
| Sma3 | Flavonoid 3'-hydroxylase | - | - | 5.495e-28 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:1.14.-.- | - | 1.331e-07 | - | |
| Sma3 | Flavonoid 3'-monooxygenase. | EC:1.14.13.21 | - | 2.719e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 2.719e-07 | % | |
| Sma3 | Flavone and flavonol biosynthesis | 00944 | 2.719e-07 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.719e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.719e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.719e-07 | % | |
| Sma3 | N-methylcoclaurine 3'-monooxygenase. | EC:1.14.13.71 | - | 1.394e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Isoquinoline alkaloid biosynthesis | 00950 | 1.394e-13 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.394e-13 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.394e-13 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g33720; At2g45550; At2g45560; At2g45570; At2g45580; At3g61040; At5g07990; B1168A08.5; CYP75B1; CYP76A1; CYP76B7; CYP76C1; CYP76C2; CYP76C3; CYP76C4; CYP76D1; CYP76E1; CYP76E3; CYP76F3; CYP76F4; CYP76G4; CYP76T1; CYP76T2; CYP76T3; CYP76T5; CYP76T6; CYP8 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | flavonoid 3'-monooxygenase activity | GO:0016711 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | GO:0050381 | Molecular Function | 0.0 | - | |
| Sma3 | N-methylcoclaurine 3'-monooxygenase activity | GO:0050593 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF247, plant | IPR004158 | - | 0.0 | - |
| Sma3 | GC-rich sequence DNA-binding factor | IPR012890 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G61040.1 | CYP76C7 cytochrome P450, family 76, subfamily C, polypeptide 7 chr3:22594074-22596125 REVERSE LENGTH=498 | 2.0e-22 | 66% |
| RefSeq | Arabidopsis thaliana | NP_191663.1 | cytochrome P450, family 76, subfamily C, polypeptide 7 [Arabidopsis thaliana] | 3.0e-22 | 66% |
| RefSeq | Populus trichocarpa | XP_002336802.1 | cytochrome P450 [Populus trichocarpa] | 4.0e-25 | 69% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A813
Fln msg: Distance to subject end: 21 aas, your sequence is shorter than subject: 59 - 321
Fln protein:
E
Protein Length:
60
Fln nts:
T
Fln Alignment:
CL17915Contig1___ELIPFGAGRRICPGLPLAHRMVHVVIASLFHYFDWSLPDGVTPENMDMSEKFGITLQR
D5A813_______________ELIPSGAGRRICPGLPLAHRMVHVVIASLLHSFNWSLPDGITADNMDMTEKFGITLQR

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta