UniGene Name: sp_v3.0_unigene50823
Length: 171 nt
UniGene Fasta |
---|
>sp_v3.0_unigene50823
C |
Ace file of the UniGene sp_v3.0_unigene50823 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cellulose synthase-like D3, glycosyltransferase family 2 protein n=4 Tax=Physcomitrella patens RepID=A9SS17_PHYPA | - | - | 9.0e-21 | 85% |
FL-Next | tr=Cellulose synthase; Pinus radiata (Monterey pine) (Pinus insignis). | - | - | 0.0 | 53% |
Sma3 | Cellulose synthase-like protein D4 | - | - | 4.708e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 5.34e-24 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 4.224e-12 | % |
Source | Gene names |
---|---|
Sma3 | At1g02730; At1g32180; At2g33100; At3g03050; At4g38190; At5g16910; CSLD1; CSLD2; CSLD3; CSLD4; CSLD5; CSLD6; CslD1; F20D10.310; F22D16.26; F25I18.16; F2K13.60; F3C3.4; GSVIVT00014029001; GSVIVT00015671001; GSVIVT00028062001; GSVIVT00031177001; GSVIVT000363 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | integral to Golgi membrane | GO:0030173 | Cellular Component | 0.0 | - |
Sma3 | cellulose synthase (UDP-forming) activity | GO:0016760 | Molecular Function | 0.0 | - |
Sma3 | 1,4-beta-D-xylan synthase activity | GO:0047517 | Molecular Function | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
Sma3 | cell wall biogenesis | GO:0042546 | Biological Process | 0.0 | - |
Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cellulose synthase | IPR005150 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G03050.1 | CSLD3, KJK, ATCSLD3 cellulose synthase-like D3 chr3:687873-691629 FORWARD LENGTH=1145 | 5.0e-25 | 82% |
RefSeq | Arabidopsis thaliana | NP_186955.1 | cellulose synthase-like protein D3 [Arabidopsis thaliana] | 7.0e-25 | 82% |
RefSeq | Populus trichocarpa | XP_002328950.1 | glycosyltransferase, CAZy family GT2 [Populus trichocarpa] | 6.0e-26 | 85% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q4VWW7
Fln msg: Distance to subject end: 187 aas, your sequence is shorter than subject: 56 - 1096
Fln protein:
N
Protein Length:
57
Fln nts:
C
Fln Alignment:
CL17665Contig1___RMKFLQRISYINVGIYPFTSIFLMVYCFLPALSLFTGQFIVQKLS
Q4VWW7_______________RLKWLERLAYINTTVYPITSIPLLAYCTLPAICLLTGKFIIPEIS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain