|
||||||
|
UniGene Name: sp_v3.0_unigene50784
Length: 146 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene50784
T |
|
Ace file of the UniGene sp_v3.0_unigene50784
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | myosin heavy chain class XI E3 protein, putative [Oryza sativa Japonica Group] | - | - | 7.0e-13 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). | - | - | 0.0 | 79% |
| Sma3 | Myosin XI, putative | - | - | 3.097e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g17580; At2g31900; At5g20490; At5g43900; F16A16.180; F20D22.7; GSVIVT00003703001; GSVIVT00007440001; GSVIVT00007494001; GSVIVT00016505001; GSVIVT00028463001; GSVIVT00034148001; LOC_Os03g48140; LOC_Os03g53660; LOC_Os03g64290; LOC_Os10g19860; M2; MYO1; M |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
| Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | - |
| Sma3 | keratinization | GO:0031424 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G04160.1 | XIB, ATXIB, XI-8, XI-B myosin XI B chr1:1086495-1096146 FORWARD LENGTH=1500 | 2.0e-17 | 75% |
| RefSeq | Arabidopsis thaliana | NP_171912.2 | myosin XI B [Arabidopsis thaliana] | 2.0e-17 | 75% |
| RefSeq | Populus trichocarpa | XP_002329057.1 | predicted protein [Populus trichocarpa] | 4.0e-18 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D7KFH0
Fln msg: Distance to subject end: 617 aas, your sequence is shorter than subject: 48 - 1520
Fln protein:
I
Protein Length:
49
Fln nts:
T
Fln Alignment:
CL17211Contig1___IAFQCAWRCRLARKELHGLKLAERETGALREAKNKLEKRCEELTWRLQ
D7KFH0_______________IVTQCAWRCRLARRELRMLKMAARETGALTDAKNKLEKRVEELTWRLQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
