UniGene Name: sp_v3.0_unigene50736
Length: 197 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene50736
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic n=2 Tax=Arabidopsis RepID=NCED2_ARATH | - | - | 2.0e-21 | 70% |
FL-Next | tr=Putative 9-cis-epoxycarotenoid dioxygenase; Taxodium distichum (Bald cypress) (Cupressus disticha). | - | - | 0.0 | 68% |
Sma3 | 9-cis-epoxycarotenoid dioxygenase | - | - | 6.352e-36 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 9-cis-epoxycarotenoid dioxygenase. | EC:1.13.11.51 | - | 1.955e-26 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Carotenoid biosynthesis | 00906 | 1.955e-26 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.955e-26 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.955e-26 | % | |
Sma3 | Metabolic pathways | 01100 | 1.955e-26 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.955e-26 | % | |
Sma3 | Beta-carotene 15,15'-monooxygenase. | EC:1.14.99.36 | - | 6.846e-07 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Retinol metabolism | 00830 | 6.846e-07 | % | |
Sma3 | Metabolic pathways | 01100 | 6.846e-07 | % |
Source | Gene names |
---|---|
Sma3 | At1g30100; At1g78390; At3g14440; At3g24220; At4g18350; CPRD65; CitNCED2; CitNCED3; CmNCED3a; CmNCED3b; DNCED1; F28J12.10; F3F9.10; GSVIVT00000988001; GSVIVT00020467001; HvNCED1; HvNCED2; LOC_Os03g44380; LOC_Os12g42280; LsNCED1; LsNCED2; LsNCED3; LsNCED4; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
Sma3 | 9-cis-epoxycarotenoid dioxygenase activity | GO:0045549 | Molecular Function | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | abscisic acid biosynthetic process | GO:0009688 | Biological Process | 0.0 | - |
Sma3 | response to red light | GO:0010114 | Biological Process | 0.0 | - |
Sma3 | hyperosmotic salinity response | GO:0042538 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protamine P1 | IPR000221 | - | 0.0 | - |
Sma3 | Carotenoid oxygenase | IPR004294 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G18350.1 | NCED2, ATNCED2 nine-cis-epoxycarotenoid dioxygenase 2 chr4:10142672-10144423 FORWARD LENGTH=583 | 1.0e-27 | 70% |
RefSeq | Arabidopsis thaliana | NP_193569.1 | 9-cis-epoxycarotenoid dioxygenase NCED2 [Arabidopsis thaliana] | 1.0e-27 | 70% |
RefSeq | Populus trichocarpa | XP_002316710.1 | predicted protein [Populus trichocarpa] | 7.0e-23 | 60% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q0EEH1
Fln msg: Distance to subject end: 381 aas, your sequence is shorter than subject: 65 - 631
Fln protein:
G
Protein Length:
66
Fln nts:
T
Fln Alignment:
CL16664Contig1___GANPRFEPRGGHHLFDGDGMIHAVTLRHGKASYGCRFTKTERFVSEERAGQSFYPKPIGELHGH
Q0EEH1_______________GANPLFEPLAGHHFFDGDGMVHAVRLKQGIASYCSRFTRTHRLVEEEKLGRAFYPKAIGELHGH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain