|
||||||
|
UniGene Name: sp_v3.0_unigene50691
Length: 208 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene50691
T |
|
Ace file of the UniGene sp_v3.0_unigene50691
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cullin 1C [Nicotiana tabacum] | - | - | 2.0e-27 | 84% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Sma3 | Putative cullin | - | - | 6.495e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | AXR6; At1g02980; At1g02980/F22D16_2; At4g02570; CUL1; CUL1-C; CUL1-G; F22D16.2; GSVIVT00019763001; GSVIVT00023565001; MICPUCDRAFT_45869; OJ1504_G04.11; OSJNBa0010P20.16; OSJNBa0010P20.19; Os01g0369000; Os01g0369200; Os05g0149600; OsI_01951; OsI_01952; OsI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | condensed nuclear chromosome | GO:0000794 | Cellular Component | 0.0 | - |
| Sma3 | spindle | GO:0005819 | Cellular Component | 0.0 | - |
| Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | cullin-RING ubiquitin ligase complex | GO:0031461 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin protein ligase binding | GO:0031625 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | jasmonic acid mediated signaling pathway | GO:0009867 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | SCF complex assembly | GO:0010265 | Biological Process | 0.0 | - |
| Sma3 | regulation of circadian rhythm | GO:0042752 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cullin, N-terminal | IPR001373 | - | 0.0 | - |
| Sma3 | Protein translocase complex, SecE/Sec61-gamma subunit | IPR001901 | - | 0.0 | - |
| Sma3 | Winged helix-turn-helix transcription repressor DNA-binding | IPR011991 | - | 0.0 | - |
| Sma3 | Cullin, conserved site | IPR016157 | - | 0.0 | - |
| Sma3 | Cullin homology | IPR016158 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02570.1 | ATCUL1, CUL1, AXR6 cullin 1 chr4:1129315-1133435 FORWARD LENGTH=738 | 4.0e-32 | 78% |
| RefSeq | Arabidopsis thaliana | NP_001190661.1 | cullin 1 [Arabidopsis thaliana] | 5.0e-32 | 78% |
| RefSeq | Populus trichocarpa | XP_002314453.1 | predicted protein [Populus trichocarpa] | 1.0e-33 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQB2
Fln msg: Distance to subject end: 186 aas, your sequence is shorter than subject: 69 - 744
Fln protein:
Q
Protein Length:
70
Fln nts:
T
Fln Alignment:
CL16274Contig1___QTNFEEYLNGNPLAHPGIDLTLKVLTTGFWPSYKSFGLINLPAEMVKCVEVFKEFYQTKTKHRKLTWIY
B8LQB2_______________QTNFEEYLNENPLAHPGIDLTVTVLTTGFWPSYKSFDL-NLPAEMVKCVEVFKEFYQTKTKHRKLTWIY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
