UniGene Name: sp_v3.0_unigene50443
Length: 188 nt
UniGene Fasta |
---|
>sp_v3.0_unigene50443
T |
Ace file of the UniGene sp_v3.0_unigene50443 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] ref|NP_001185050.1| putative U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] gb|AAD30595.1|AC007369_5 Putative RNA helicase [Arabidopsis thaliana] gb|AEE30046.1 | - | - | 9.0e-27 | 90% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 98% |
Source | Gene names |
---|---|
Sma3 | At1g20960; At2g42270; CHLREDRAFT_123427; F9H16.5; GSVIVT00001949001; GSVIVT00016213001; LOC_Os03g53220; MICPUCDRAFT_48293; MICPUCDRAFT_63; MICPUN_98172; OSJNBb0036F07.6; OSTLU_44002; OsI_05501; OsI_10511; OsI_13469; OsJ_05035; OsJ_09899; OsJ_12529; PHATRD |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | ribonucleoprotein complex | GO:0030529 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000097 | - | 0.0 | - | |
Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Sec63 domain | IPR004179 | - | 0.0 | - |
Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | IPR018127 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G20960.1 | emb1507 U5 small nuclear ribonucleoprotein helicase, putative chr1:7302591-7309914 REVERSE LENGTH=2171 | 3.0e-33 | 90% |
RefSeq | Arabidopsis thaliana | NP_001185050.1 | putative U5 small nuclear ribonucleoprotein helicase [Arabidopsis thaliana] | 4.0e-33 | 90% |
RefSeq | Populus trichocarpa | XP_002322252.1 | predicted protein [Populus trichocarpa] | 5.0e-36 | 98% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6HYS8
Fln msg: Distance to subject end: 1262 aas, your sequence is shorter than subject: 62 - 2067
Fln protein:
A
Protein Length:
63
Fln nts:
T
Fln Alignment:
CL13603Contig1___AHTVIIKGTQIYNPEKGAWTELSPLDIMQMLGRAGRPQYDSYGEGIIITGHSELQYYLSLMN
F6HYS8_______________AHTVIIKGTQIYNPEKGAWTELSPLDVMQMLGRAGRPQYDSYGEGIIITGHSELQYYLSLMN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain