UniGene Name: sp_v3.0_unigene50396
Length: 245 nt
![]() |
---|
>sp_v3.0_unigene50396
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Seryl-tRNA synthetase n=4 Tax=Andropogoneae RepID=B6TBG7_MAIZE | - | - | 9.0e-26 | 67% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
Sma3 | Seryl-tRNA synthetase, putative | - | - | 1.765e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Serine--tRNA ligase. | EC:6.1.1.11 | - | 7.646e-11 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminoacyl-tRNA biosynthesis | 00970 | 7.646e-11 | % |
Source | Gene names |
---|---|
Sma3 | At1g11870; F12F1.29; GSVIVT00011042001; LOC_Os11g39670; MICPUN_58112; Os11g0610900; OsI_23053; OsJ_26871; PHYPADRAFT_145532; POPTRDRAFT_816363; RCOM_0788250; RCOM_1037230; RCOM_1037390; RCOM_2137500; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | serine-tRNA ligase activity | GO:0004828 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | seryl-tRNA aminoacylation | GO:0006434 | Biological Process | 0.0 | - |
Sma3 | protein modification process | GO:0006464 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ubiquitin | IPR000626 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class II (G/ H/ P/ S), conserved domain | IPR002314 | - | 0.0 | - |
Sma3 | Seryl-tRNA synthetase, class IIa | IPR002317 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class II | IPR006195 | - | 0.0 | - |
Sma3 | Seryl-tRNA synthetase, class IIa, N-terminal | IPR015866 | - | 0.0 | - |
Sma3 | IPR018156 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G11870.2 | - | 7.0e-31 | 62% |
RefSeq | Arabidopsis thaliana | NP_973812.1 | Seryl-tRNA synthetase [Arabidopsis thaliana] | 4.0e-31 | 62% |
RefSeq | Populus trichocarpa | XP_002301073.1 | predicted protein [Populus trichocarpa] | 4.0e-32 | 69% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LM11
Fln msg: Distance to subject end: 284 aas, your sequence is shorter than subject: 81 - 542
Fln protein:
H
Protein Length:
82
Fln nts:
G
Fln Alignment:
CL13054Contig1___HLKDNLVTLEEDLTQLTDKLQREAQSIPNSTHPDVPIGGEDAASLRKMFGTKCEFDFPVKDHVDIGQELDLFDFDAAAEVS
B8LM11_______________HLKDNLVALEEDLAQLTDKLQREAQSIPNSTHPDVPIGGEDAASLRKMVGTKCEFDFPVKDHVDLGQELDLFDFDAAAEVS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain