SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene50185

Length: 252 nt

UniGene Fasta

>sp_v3.0_unigene50185
TGCTAAATTTATCTGGCAACCAGTTGGAAGGGCCAATCCCATCATCTCTCAGTAACATATCTACTCTGGAGCAGTTAGACTTGAGCAAGAATAATCTCAATGGACAGATTCCTCAAGAGCTCTCTAAACTATATAGTTTGGCTGTTCTCGATGTTTCATCTAATAACCTTTGTGGGCCAATCCCTGGAGGAACACAATTTTCTACATTCAGTGCAACATCATTTCAAAGGAATAAATGCTTACATGGGTGTC

Ace file of the UniGene sp_v3.0_unigene50185

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Verticillium wilt disease resistance protein n=14 Tax=Solanum RepID=C4NAS5_SOLLC	-	-	3.0e-18	59%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	78%
Sma3	Ve resistance gene analog	-	-	7.974e-23	-

Source	ECs	Term	Type	e value	Identity
Sma3	2-alkenal reductase.	EC:1.3.1.74	-	2.884e-06	-

Source	Gene names
Sma3	9DC1; 9DC2; 9DC3; At1g74190; At2g15080; At2g25470; At2g32660; At3g05660; At3g23010; At3g53240; Cf-4; Cf-4A; Cf-5; Cf-9; F18C1.7; F1O17.14; F20D21.29; F9E11.4; GSVIVT00000950001; GSVIVT00001326001; GSVIVT00001330001; GSVIVT00001335001; GSVIVT00001339001; G

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism	GO:0015662	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	ATP biosynthetic process	GO:0006754	Biological Process	-
Sma3	cation transport	GO:0006812	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	GPCR, rhodopsin-like, 7TM	IPR000276	-	-
Sma3	Nitrogenase component 1, conserved site	IPR000318	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain	IPR001327	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter	IPR001757	-	-
Sma3	Leucine-rich repeat, typical subtype	IPR003591	-	-
Sma3	ATPase, P-type cation-transporter, C-terminal	IPR006068	-	-
Sma3	ATPase, P-type, ATPase-associated domain	IPR008250	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Leucine-rich repeat 2	IPR013101	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Peroxidases heam-ligand binding site	IPR019793	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G05660.1	AtRLP33, RLP33 receptor like protein 33 chr3:1649258-1652001 REVERSE LENGTH=875	4.0e-21	54%
RefSeq	Arabidopsis thaliana	NP_187217.2	receptor like protein 33 [Arabidopsis thaliana]	5.0e-21	54%
RefSeq	Populus trichocarpa	XP_002323000.1	predicted protein [Populus trichocarpa]	4.0e-22	58%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PTA1

Fln msg: Distance to subject end: 58 aas, your sequence is shorter than subject: 83 - 946

Fln protein: LNLSGNQLEGPIPSSLSNISTLEQLDLSKNNLNGQIPQELSKLYSLAVLDVSSNNLCGPIPGGTQFSTFSATSFQRNKCLHGC

Protein Length: 84

Fln nts: TGCTAAATTTATCTGGCAACCAGTTGGAAGGGCCAATCCCATCATCTCTCAGTAACATATCTACTCTGGAGCAGTTAGACTTGAGCAAGAATAATCTCAATGGACAGATTCCTCAAGAGCTCTCTAAACTATATAGTTTGGCTGTTCTCGATGTTTCATCTAATAACCTTTGTGGGCCAATCCCTGGAGGAACACAATTTTCTACATTCAGTGCAACATCATTTCAAAGGAATAAATGCTTACATGGGTGTC

Fln Alignment:

CL9741Contig1___LNLSGNQLEGPIPSSLSNISTLEQLDLSKNNLNGQIPQELSKLYSLAVLDVSSNNLCGPIPGGTQFSTFSATSFQRNKCLHG
C0PTA1_______________LNLSGNQLEGVIPASLGNISTLEELDLSKNHLKGEIPEGLSKLHELAVLDVSSNHLCGPIPRGTQFSTFNVTSFQENHCLCG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain