UniGene Name: sp_v3.0_unigene50109
Length: 227 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene50109
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative heavy metal transporter [Arabidopsis thaliana] | - | - | 3.0e-07 | 44% |
FL-Next | sp=Putative cadmium/zinc-transporting ATPase HMA4; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 65% |
Sma3 | p-type ATPase superfamily | - | - | 6.589e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cadmium-exporting ATPase. | EC:3.6.3.3 | - | 1.659e-13 | - |
Sma3 | Zinc-exporting ATPase. | EC:3.6.3.5 | - | 1.659e-13 | - |
Source | Gene names |
---|---|
Sma3 | ATPase2; ATPase5-1B; AhHMA4-1; AhHMA4-2; AhHMA4-3; At2g19110; At4g30110; At4g30120; CA7; CHLREDRAFT_77047; F6G3.140; F6G3.150; GSVIVT00001529001; GSVIVT00023099001; HMA2; HMA3; HMA4; Hma1; MICPUCDRAFT_50631; MICPUN_58693; MICPUN_85385; MICPUN_94613; OSTLU |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | copper-exporting ATPase activity | GO:0004008 | Molecular Function | 0.0 | - |
Sma3 | cation channel activity | GO:0005261 | Molecular Function | 0.0 | - |
Sma3 | calcium-transporting ATPase activity | GO:0005388 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | cadmium-exporting ATPase activity | GO:0008551 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
Sma3 | zinc-exporting ATPase activity | GO:0016463 | Molecular Function | 0.0 | - |
Sma3 | cadmium ion binding | GO:0046870 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | metal ion transmembrane transporter activity | GO:0046873 | Molecular Function | 0.0 | - |
Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
Sma3 | calcium ion transport | GO:0006816 | Biological Process | 0.0 | - |
Sma3 | copper ion transport | GO:0006825 | Biological Process | 0.0 | - |
Sma3 | zinc ion transport | GO:0006829 | Biological Process | 0.0 | - |
Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O64474
Fln msg: Distance to subject end: 514 aas, your sequence is shorter than subject: 75 - 1172
Fln protein:
V
Protein Length:
76
Fln nts:
A
Fln Alignment:
CL8878Contig1___RIIGELKQVGKTAMIGXXXXXXXXXXXXXXXXXXGVAGSAVAMETSDIALMSNDIRKIAAAVKIGRRTLRKI
O64474_______________RIIQEFKKEGPTAMVGDGVNDAPALATADIGISMGISGSALATQTGNIILMSNDIRRIPQAVKLARRARRKV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain