|
||||||
|
UniGene Name: sp_v3.0_unigene50103
Length: 203 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene50103
G |
|
Ace file of the UniGene sp_v3.0_unigene50103
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative ent-Kaurenoic acid hydroxylase-like cytochrome P450 n=1 Tax=Ginkgo biloba RepID=Q6J4H0_GINBI | - | - | 6.0e-19 | 71% |
| FL-Next | sp=Ent-kaurenoic acid oxidase 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 63% |
| Sma3 | Ent-kaurenoic acid oxidase | - | - | 5.771e-21 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ent-kaurenoic acid oxidase. | EC:1.14.13.79 | - | 8.181e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 8.181e-13 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 8.181e-13 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 8.181e-13 | % | |
| Sma3 | Metabolic pathways | 01100 | 8.181e-13 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.181e-13 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g05160; At2g32440; CYP88A1; CYP88A2; CYP88A3; CYP88A4; CYP88A8; CYP88A9; D3; GPR5; GSVIVT00018965001; GSVIVT00018966001; KAO1; KAO2; LsKAO; POPTRDRAFT_571955; POPTRDRAFT_688380; RCOM_0659440; T32F6.4; YUP8H12.23; kao; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | ent-kaurenoate oxidase activity | GO:0051777 | Molecular Function | 0.0 | - |
| Sma3 | gibberellin biosynthetic process | GO:0009686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, B-class | IPR002397 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G32440.1 | KAO2, CYP88A4, ATKAO2 ent-kaurenoic acid hydroxylase 2 chr2:13775668-13777783 FORWARD LENGTH=489 | 2.0e-21 | 63% |
| RefSeq | Arabidopsis thaliana | NP_001189657.1 | Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana] | 2.0e-21 | 63% |
| RefSeq | Populus trichocarpa | XP_002321248.1 | cytochrome P450 probable ent-kaurenoic acid oxidase [Populus trichocarpa] | 4.0e-21 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9C5Y2
Fln msg: Distance to subject end: 176 aas, your sequence is shorter than subject: 67 - 489
Fln protein:
A
Protein Length:
68
Fln nts:
G
Fln Alignment:
CL8806Contig1___AILQSVIDKRRSGQEKNDDKNG-DMLDSLLQVKDENGRFLTDEEIIDLLVMYLNAGHESSAHITMW
Q9C5Y2_______________AAFQSIVTNRRNQRKQNISSNRKDMLDNLIDVKDENGRVLDDEEIIDLLLMYLNAGHESSGHLTMW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
