UniGene Name: sp_v3.0_unigene50050
Length: 233 nt
![]() |
---|
>sp_v3.0_unigene50050
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | MDR-like ABC transporter n=1 Tax=Taxus cuspidata RepID=E6Y0T0_TAXCU | - | - | 2.0e-11 | 45% |
FL-Next | tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew). | - | - | 0.0 | 63% |
Sma3 | Multidrug resistance protein 1, 2, putative | - | - | 1.131e-18 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphate-transporting ATPase. | EC:3.6.3.27 | - | 5.847e-07 | - |
Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 8.389e-16 | - |
Source | Gene names |
---|---|
Sma3 | At2g47000; At4g18050; At5g46540; Cjmdr1; F14M4.17; F15J5.20; GSVIVT00003365001; GSVIVT00003375001; GSVIVT00003377001; GSVIVT00019729001; GSVIVT00028243001; K11I1.13; MDR4; MDR7; MDR9; Os01g0695700; OsI_03376; OsI_03383; OsJ_03114; OsJ_03121; P0431H09.36; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
Sma3 | auxin efflux | GO:0010315 | Biological Process | 0.0 | - |
Sma3 | basipetal auxin transport | GO:0010540 | Biological Process | 0.0 | - |
Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
Sma3 | IPR013596 | - | 0.0 | - | |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G47000.1 | MDR4, PGP4, ABCB4, ATPGP4 ATP binding cassette subfamily B4 chr2:19310008-19314750 REVERSE LENGTH=1286 | 2.0e-14 | 55% |
RefSeq | Arabidopsis thaliana | NP_182223.1 | ABC transporter B family member 4 [Arabidopsis thaliana] | 3.0e-14 | 55% |
RefSeq | Populus trichocarpa | XP_002301547.1 | multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] | 1.0e-13 | 54% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E6Y0T0
Fln msg: Distance to subject end: 975 aas, your sequence is shorter than subject: 77 - 1316
Fln protein:
G
Protein Length:
78
Fln nts:
C
Fln Alignment:
CL8158Contig1___GEKNAVTDYEKSLTIXXXXXXXXXXXXXXXXXXXXXXXXCSYALALWYGSRLVINGGYSGGSVINIILAILTGGMSL
E6Y0T0_______________GEKKSIEGYNKSLAIAYNAITQQGLVAGVGLGSVLFIMFCGYALALWYGSRLILDGSYTGGDVINVIFAVLMGGMSL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain