UniGene Name: sp_v3.0_unigene50013
Length: 189 nt
![]() |
---|
>sp_v3.0_unigene50013
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | histone-lysine N-methyltransferase SETD2 [Arabidopsis thaliana] gb|AEE35961.1| histone-lysine N-methyltransferase SETD2 [Arabidopsis thaliana] | - | - | 2.0e-18 | 63% |
FL-Next | sp=Histone-lysine N-methyltransferase ASHH2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 63% |
Sma3 | SET domain protein | - | - | 4.079e-06 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Histone-lysine N-methyltransferase. | EC:2.1.1.43 | - | 7.989e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lysine degradation | 00310 | 7.989e-06 | % |
Source | Gene names |
---|---|
Sma3 | ASHH2; At1g77300; EFS; GSVIVT00015453001; Os02g0554000; P0470G10.13; PHYPADRAFT_70599; PHYPADRAFT_89432; POPTRDRAFT_204626; POPTRDRAFT_551417; RCOM_0561810; SDG1517; SDG1547; SDG8; SDG922; SDG923; SET8; T14N5.15; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome, centromeric region | GO:0000775 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | histone-lysine N-methyltransferase activity | GO:0018024 | Molecular Function | 0.0 | - |
Sma3 | histone methyltransferase activity (H3-K4 specific) | GO:0042800 | Molecular Function | 0.0 | - |
Sma3 | negative regulation of flower development | GO:0009910 | Biological Process | 0.0 | - |
Sma3 | secondary shoot formation | GO:0010223 | Biological Process | 0.0 | - |
Sma3 | carotenoid metabolic process | GO:0016116 | Biological Process | 0.0 | - |
Sma3 | positive regulation of histone methylation | GO:0031062 | Biological Process | 0.0 | - |
Sma3 | regulation of gene expression, epigenetic | GO:0040029 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SET domain | IPR001214 | - | 0.0 | - |
Sma3 | Post-SET domain | IPR003616 | - | 0.0 | - |
Sma3 | AWS | IPR006560 | - | 0.0 | - |
Sma3 | Zinc finger, CW-type | IPR011124 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G77300.1 | " EFS, SDG8, CCR1, ASHH2, LAZ2 histone methyltransferases(H3-K4 specific);histone methyltransferases(H3-K36 specific) chr1:29040160-29048810 REVERSE LENGTH=1805" | 1.0e-23 | 63% |
RefSeq | Arabidopsis thaliana | NP_001077836.1 | histone-lysine N-methyltransferase SETD2 [Arabidopsis thaliana] | 2.0e-23 | 63% |
RefSeq | Populus trichocarpa | XP_002307459.1 | SET domain protein, partial [Populus trichocarpa] | 3.0e-25 | 67% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q2LAE1
Fln msg: Distance to subject end: 740 aas, your sequence is shorter than subject: 62 - 1759
Fln protein:
L
Protein Length:
63
Fln nts:
A
Fln Alignment:
CL7803Contig1___ISRSVYKHRSRKIQLMDEILVCQCKPPEDGRLGCGDGCLNRLLNIECIPGTCPCGEKCSNQ
Q2LAE1_______________IKTNQFLHRNRKSQTIDEIMVCHCKPSPDGRLGCGEECLNRMLNIECLQGTCPAGDLCSNQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain