UniGene Name: sp_v3.0_unigene49501
Length: 197 nt
![]() |
---|
>sp_v3.0_unigene49501
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Extensin-like protein n=2 Tax=Arabidopsis RepID=O49448_ARATH | - | - | 2.0e-20 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 39% |
Sma3 | Extensin-like protein | - | - | 2.105e-23 | - |
Source | Gene names |
---|---|
Sma3 | AT4g13340; AT4g18670; AT4g28380; AT4g33970; At1g12040; At1g49490; At2g19780; At3g19020; At3g22800; At3g24480; At4g13340; At4g18670; At4g28380; At4g33970; At5g25550; B1103C09.1-1; B1103C09.1-2; F12F1.9; F13F21.7; F17I5.160; F20O9.70; F28A21.80; GSVIVT00016 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleosome | GO:0000786 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of cell wall | GO:0005199 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | cell morphogenesis involved in differentiation | GO:0000904 | Biological Process | 0.0 | - |
Sma3 | nucleosome assembly | GO:0006334 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | plant-type cell wall organization | GO:0009664 | Biological Process | 0.0 | - |
Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
Sma3 | trichoblast differentiation | GO:0010054 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Histone H2B | IPR000558 | - | 0.0 | - |
Sma3 | Intradiol ring-cleavage dioxygenase, C-terminal | IPR000627 | - | 0.0 | - |
Sma3 | Flavodoxin, conserved site | IPR001226 | - | 0.0 | - |
Sma3 | Ribosomal protein S3Ae | IPR001593 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Repetitive proline-rich cell wall protein repeat | IPR003883 | - | 0.0 | - |
Sma3 | Extensin repeat | IPR006706 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Ribosomal protein S3Ae, conserved site | IPR018281 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G28380.1 | Leucine-rich repeat (LRR) family protein chr4:14039756-14040931 REVERSE LENGTH=391 | 2.0e-27 | 73% |
RefSeq | Arabidopsis thaliana | NP_194567.1 | leucine-rich repeat-containing protein [Arabidopsis thaliana] | 3.0e-27 | 73% |
RefSeq | Populus trichocarpa | XP_002331740.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-27 | 70% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LS28
Fln msg: Distance to subject end: 334 aas, your sequence is shorter than subject: 65 - 610
Fln protein:
I
Protein Length:
66
Fln nts:
G
Fln Alignment:
CL22665Contig1___ILPHSFKNMTQLYELDISNNRFAGPFPKVALHLPSLKYLDIRFNEFEGKLPTKLFD
B8LS28_______________VLPTTLKNIRGLQSLDINGNILSGPIPAFLGSFVNLTYLDLSGNEFTGPIPASIAD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain