UniGene Name: sp_v3.0_unigene49389
Length: 221 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene49389
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | dynamin-like protein E [Arabidopsis thaliana] emb|CAB75934.1| dynamin-like protein 4 (ADL4) [Arabidopsis thaliana] | - | - | 3.0e-24 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
Sma3 | Dynamin, putative | - | - | 2.826e-17 | - |
Source | Gene names |
---|---|
Sma3 | ADL1; ADL1A; ADL1B; ADL1C; ADL1D; ADL1E; ADL4; ADL5; AG68; At1g14830; At2g44590; At3g60190; At3g61760; At5g42080; B1130E07.11; B1331F11.31; DLP1; DLP2; DLP3; DRP1A; DRP1B; DRP1C; DRP1D; DRP1E; F10B6.23; F15G16.150; F16B22.8; GSVIVT00001878001; GSVIVT00006 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell cortex | GO:0005938 | Cellular Component | 0.0 | - |
Sma3 | cell plate | GO:0009504 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | mitochondrial fission | GO:0000266 | Biological Process | 0.0 | - |
Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | cell plate formation involved in plant-type cell wall biogenesis | GO:0009920 | Biological Process | 0.0 | - |
Sma3 | xylem and phloem pattern formation | GO:0010051 | Biological Process | 0.0 | - |
Sma3 | trichome branching | GO:0010091 | Biological Process | 0.0 | - |
Sma3 | pollen maturation | GO:0010152 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Dynamin central domain | IPR000375 | - | 0.0 | - |
Sma3 | Dynamin, GTPase domain | IPR001401 | - | 0.0 | - |
Sma3 | Dynamin GTPase effector | IPR003130 | - | 0.0 | - |
Sma3 | Dynamin, GTPase region, conserved site | IPR019762 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G60190.1 | ADL4, ADLP2, EDR3, DRP1E, ADL1E, DL1E DYNAMIN-like 1E chr3:22244367-22247651 REVERSE LENGTH=624 | 1.0e-30 | 71% |
RefSeq | Arabidopsis thaliana | NP_567094.1 | dynamin-related protein 1E [Arabidopsis thaliana] | 2.0e-30 | 71% |
RefSeq | Populus trichocarpa | XP_002302482.1 | predicted protein [Populus trichocarpa] | 6.0e-31 | 72% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LS11
Fln msg: Distance to subject end: 478 aas, your sequence is shorter than subject: 73 - 615
Fln protein:
F
Protein Length:
74
Fln nts:
T
Fln Alignment:
CL21240Contig1___FFPRGSGIITRRPLVLQLHKIDANQQEYAEFLHIPKKRFTDYAAVQKEIQGETDRVAGHMKRISPSPIHLSIF
B8LS11_______________FLPRGSGIVTRRPLVLQLHKTDDGSPDYAEFLHLPNKRFTDFARVRNEIQEETDRVTGRSKMISPVPIHLSIY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain