|
||||||
|
UniGene Name: sp_v3.0_unigene49368
Length: 211 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene49368
G |
|
Ace file of the UniGene sp_v3.0_unigene49368
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative methyltransferase PMT24 [Arabidopsis thaliana] ref|NP_001031109.1| putative methyltransferase PMT24 [Arabidopsis thaliana] sp|Q6NPR7.1|PMTO_ARATH RecName: Full=Probable methyltransferase PMT24 gb|AAR23721.1| At1g29470 [Arabidopsis thaliana] gb|AE | - | - | 9.0e-24 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
| Sma3 | ATP binding protein, putative | - | - | 1.233e-18 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4G18030; AT4G19120; AT4g00750; AT4g14360; AT4g19120; At1g04430; At1g04430/F19P19.11; At1g29470; At1g77260; At2g34300; At2g39750; At2g40280; At2g43143; At2g43200; At3g10200; At3g23300; At3g51070; At4g00750; At4g14360; At4g19120; At5g04060; At5g06050; At5 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 10 | IPR001000 | - | 0.0 | - |
| Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
| Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
| Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
| Sma3 | Putative S-adenosyl-L-methionine-dependent methyltransferase | IPR004159 | - | 0.0 | - |
| Sma3 | Cytokine-induced anti-apoptosis inhibitor 1 | IPR007785 | - | 0.0 | - |
| Sma3 | IPR017909 | - | 0.0 | - | |
| Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
| Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G29470.1 | S-adenosyl-L-methionine-dependent methyltransferases superfamily protein chr1:10310424-10313369 REVERSE LENGTH=770 | 6.0e-30 | 71% |
| RefSeq | Arabidopsis thaliana | NP_001031109.1 | putative methyltransferase PMT24 [Arabidopsis thaliana] | 8.0e-30 | 71% |
| RefSeq | Populus trichocarpa | XP_002336996.1 | predicted protein [Populus trichocarpa] | 3.0e-32 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMQ4
Fln msg: Distance to subject end: 358 aas, your sequence is shorter than subject: 69 - 626
Fln protein:
Y
Protein Length:
70
Fln nts:
G
Fln Alignment:
CL21024Contig1___YINFIEKVFPNVAWGTRTRVVLDVGCGVASFGGYLFDKGVLTMSVAPKDEHEAQIQLALERGIPAILGV
B8LMQ4_______________YIDDIDKLIPLTDGSIRTAI--DTGCGVASWGAYLLKRNILTMSFAPRDTHEAQVQFALERGVPAMIGI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
