|
||||||
|
UniGene Name: sp_v3.0_unigene48934
Length: 202 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene48934
T |
|
Ace file of the UniGene sp_v3.0_unigene48934
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Probable histone acetyltransferase HAC-like 1 n=4 Tax=Poaceae RepID=HACL1_ORYSJ | - | - | 9.0e-34 | 95% |
| FL-Next | sp=Probable histone acetyltransferase HAC-like 1; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 95% |
| Sma3 | Histone acetyltransferase | - | - | 5.081e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histone acetyltransferase. | EC:2.3.1.48 | - | 6.165e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g16710; At1g55970; At1g79000; At3g12980; CHLREDRAFT_145462; F14J16.27; F17F16.8; F17F16_21; GSVIVT00029724001; HAC1; HAC12; HAC1501; HAC1502; HAC3501; HAC4; HAC5; HAC901; HAC902; HAC903; Loc_Os02g04490; Loc_Os06g49130; MGH6.20; MGH6_9; MICPUCDRAFT_6021 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | transcription cofactor activity | GO:0003712 | Molecular Function | 0.0 | - |
| Sma3 | transcription coactivator activity | GO:0003713 | Molecular Function | 0.0 | - |
| Sma3 | histone acetyltransferase activity | GO:0004402 | Molecular Function | 0.0 | - |
| Sma3 | GO:0004406 | Molecular Function | 0.0 | - | |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein acetylation | GO:0006473 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | chromatin modification | GO:0016568 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Zinc finger, TAZ-type | IPR000197 | - | 0.0 | - |
| Sma3 | Zinc finger, ZZ-type | IPR000433 | - | 0.0 | - |
| Sma3 | Bromodomain | IPR001487 | - | 0.0 | - |
| Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
| Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | IPR009255 | - | 0.0 | - | |
| Sma3 | Multihaem cytochrome | IPR011031 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G79000.2 | HAC1 histone acetyltransferase of the CBP family 1 chr1:29716639-29723984 REVERSE LENGTH=1741 | 3.0e-40 | 94% |
| RefSeq | Arabidopsis thaliana | NP_565197.3 | E1A/CREB-binding protein [Arabidopsis thaliana] | 4.00001e-40 | 94% |
| RefSeq | Populus trichocarpa | XP_002330477.1 | histone acetyltransferase [Populus trichocarpa] | 2.0e-40 | 94% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q6YXY2
Fln msg: Distance to subject end: 113 aas, your sequence is shorter than subject: 67 - 1668
Fln protein:
E
Protein Length:
68
Fln nts:
T
Fln Alignment:
CL16162Contig1___EFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNMCNHDIETGQGWRCETC
Q6YXY2_______________EFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCCHDIETGQGWRCEVC
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
