|
||||||
|
UniGene Name: sp_v3.0_unigene48913
Length: 247 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene48913
T |
|
Ace file of the UniGene sp_v3.0_unigene48913
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DNA-directed RNA polymerase n=2 Tax=Selaginella moellendorffii RepID=D8T979_SELML | - | - | 5.0e-29 | 77% |
| FL-Next | sp=DNA-directed RNA polymerase II subunit RPB2; Solanum lycopersicum (Tomato) (Lycopersicon esculentum). | - | - | 0.0 | 39% |
| Sma3 | DNA-directed RNA polymerase | - | - | 2.716e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA-directed RNA polymerase. | EC:2.7.7.6 | - | 2.51e-12 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 2.51e-12 | % | |
| Sma3 | Pyrimidine metabolism | 00240 | 2.51e-12 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.51e-12 | % |
| Source | Gene names |
|---|---|
| Sma3 | CHLREDRAFT_129857; GSVIVT00002040001; LOC_Os03g28960; MICPUCDRAFT_22087; MICPUN_86086; OSJNBb0041J20.7; OSTLU_39835; Os03g0403100; OsI_11967; OsJ_11195; Ot01g06000; PHATRDRAFT_54289; PHYPADRAFT_176819; POPTRDRAFT_900808; RCOM_0620590; RNAP-II_2; RPC2; THA |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
| Sma3 | ribonucleoside binding | GO:0032549 | Molecular Function | 0.0 | - |
| Sma3 | GO:0006350 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Domain of unknown function DUF221 | IPR003864 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase, subunit 2, domain 6 | IPR007120 | - | 0.0 | - |
| Sma3 | RNA polymerase, beta subunit, conserved site | IPR007121 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, domain 7 | IPR007641 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, domain 2 | IPR007642 | - | 0.0 | - |
| Sma3 | RNA polymerase, beta subunit, protrusion | IPR007644 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, domain 3 | IPR007645 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, domain 4 | IPR007646 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb2, domain 5 | IPR007647 | - | 0.0 | - |
| Sma3 | IPR015706 | - | 0.0 | - | |
| Sma3 | DNA-directed RNA polymerase, subunit 2 | IPR015712 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G45140.1 | NRPC2 nuclear RNA polymerase C2 chr5:18247416-18257713 REVERSE LENGTH=1161 | 7.0e-28 | 72% |
| RefSeq | Arabidopsis thaliana | NP_199327.4 | DNA-directed RNA polymerase III subunit C2 [Arabidopsis thaliana] | 9.0e-28 | 72% |
| RefSeq | Populus trichocarpa | XP_002321356.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-31 | 69% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q42877
Fln msg: Distance to subject end: 779 aas, your sequence is shorter than subject: 82 - 1191
Fln protein:
S
Protein Length:
83
Fln nts:
T
Fln Alignment:
CL15963Contig1___KVDEARDILLNVFLANVPVYQYNFRPKCIYVAVMLRRMLEAMLNSDAIDDKDYVGNKRLELAGQLIALLFEDLF
Q42877_______________RIKYAKEILQKEMLPHVGVGEYCETKKAYYFGYIIHRLLLCALGRRAEDDRDHYGNKRLDLAGPLLGGLFRMLF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
