UniGene Name: sp_v3.0_unigene48745
Length: 241 nt
![]() |
---|
>sp_v3.0_unigene48745
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Beta-galactosidase n=1 Tax=Sorghum bicolor RepID=C5YYB1_SORBI | - | - | 2.0e-26 | 72% |
FL-Next | sp=Beta-galactosidase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
Sma3 | Beta-galactosidase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-galactosidase. | EC:3.2.1.23 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Galactose metabolism | 00052 | 0.0 | % | |
Sma3 | Other glycan degradation | 00511 | 0.0 | % | |
Sma3 | Glycosaminoglycan degradation | 00531 | 0.0 | % | |
Sma3 | Sphingolipid metabolism | 00600 | 0.0 | % | |
Sma3 | Glycosphingolipid biosynthesis - ganglio series | 00604 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AT4G35010; At1g31740; At1g45130; At1g77410; At2g16730; At2g28470; At2g32810; At3g13750; At3g52840; At4g26140; At4g35010; At4g36360; At4g38590; At5g20710; At5g56870; At5g63800; BG1; BGAL1; BGAL11; BGAL12; BGAL13; BGAL14; BGAL15; BGAL16; BGAL2; BGAL3; BGAL4 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | beta-galactosidase complex | GO:0009341 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | beta-galactosidase activity | GO:0004565 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | plant-type cell wall modification | GO:0009827 | Biological Process | 0.0 | - |
Sma3 | mucilage biosynthetic process involved in seed coat development | GO:0048354 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | D-galactoside/L-rhamnose binding SUEL lectin domain | IPR000922 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 35 | IPR001944 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 2, N-terminal | IPR006104 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G38590.2 | BGAL14 beta-galactosidase 14 chr4:18036116-18040928 FORWARD LENGTH=1052 | 2.0e-32 | 72% |
RefSeq | Arabidopsis thaliana | NP_195571.2 | beta-galactosidase 14 [Arabidopsis thaliana] | 2.0e-32 | 72% |
RefSeq | Populus trichocarpa | XP_002305449.1 | predicted protein [Populus trichocarpa] | 8.0e-31 | 67% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLU8
Fln msg: Distance to subject end: 712 aas, your sequence is shorter than subject: 80 - 836
Fln protein:
M
Protein Length:
81
Fln nts:
A
Fln Alignment:
CL14167Contig1___TVQMWPGIIDKAKEGGLDCIQTYVFWNMHEPEQGKFNFAGRFDLVAFVKLIQSKGLYVSLRIGPYIESEWNFG
B8LLU8_______________TAEMWPDLFRKAKDGGLDVIQTYVFWNMHEPSPGNYNFEGRFDLVKFVKLAQEAGLYVHLRIGPYVCAEWNFG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain