UniGene Name: sp_v3.0_unigene48711
Length: 142 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene48711
G |
Ace file of the UniGene sp_v3.0_unigene48711
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phospholipase D beta 1 isoform 1b n=3 Tax=Gossypium hirsutum RepID=Q8H1U1_GOSHI | - | - | 3.0e-12 | 82% |
| FL-Next | sp=Phospholipase D; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | Phospholipase d beta, putative | - | - | 2.022e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phospholipase D. | EC:3.1.4.4 | - | 4.2039e-45 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycerophospholipid metabolism | 00564 | 4.2039e-45 | % | |
| Sma3 | Ether lipid metabolism | 00565 | 4.2039e-45 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.2039e-45 | % |
| Source | Gene names |
|---|---|
| Sma3 | A_IG005I10.13; At2g42010; At4g00240; At4g11830; At4g11840; At4g11850; At4g35790; F4B14.60; F5I10.13; GSVIVT00001073001; GSVIVT00007835001; GSVIVT00015517001; GSVIVT00026323001; GSVIVT00035483001; LOC_Os03g02740; LOC_Os03g62410; LOC_Os10g38060; OJ1263H11.7 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | phospholipase D activity | GO:0004630 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | NAPE-specific phospholipase D activity | GO:0070290 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium, incompatible interaction | GO:0009816 | Biological Process | 0.0 | - |
| Sma3 | programmed cell death | GO:0012501 | Biological Process | 0.0 | - |
| Sma3 | lipid catabolic process | GO:0016042 | Biological Process | 0.0 | - |
| Sma3 | phosphatidylcholine metabolic process | GO:0046470 | Biological Process | 0.0 | - |
| Sma3 | phosphatidic acid metabolic process | GO:0046473 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
| Sma3 | Phospholipase D/Transphosphatidylase | IPR001736 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase active site | IPR006650 | - | 0.0 | - |
| Sma3 | Phospholipase D, plant | IPR011402 | - | 0.0 | - |
| Sma3 | Phospholipase D | IPR015679 | - | 0.0 | - |
| Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G42010.1 | PLDBETA1, PLDBETA phospholipase D beta 1 chr2:17533018-17537990 REVERSE LENGTH=1083 | 3.0e-16 | 86% |
| RefSeq | Arabidopsis thaliana | NP_565963.2 | phospholipase D [Arabidopsis thaliana] | 3.0e-16 | 86% |
| RefSeq | Populus trichocarpa | XP_002320087.1 | predicted protein [Populus trichocarpa] | 3.0e-16 | 88% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ49
Fln msg: Distance to subject end: 275 aas, your sequence is shorter than subject: 46 - 861
Fln protein:
C
Protein Length:
47
Fln nts:
G
Fln Alignment:
CL13724Contig1___VVDMSIHTAYVEAIRSAQHFIYIENQYFIGSSYNW
B8LQ49_______________LVDKSIHTAYVKAIRSAQHFIYIENQYFVGSSYNW

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta