SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene48711

Length: 142 nt

UniGene Fasta

>sp_v3.0_unigene48711
GGTGTGTGCCTCCACTCCGAGAGCGAGCTCCGGTTGTGGACATGAGCATACATACAGCATATGTTGAAGCCATTCGATCTGCACAGCACTTCATTTATATTGAAAACCAATACTTCATTGGGTCATCATACAATTGGTCTGC

Ace file of the UniGene sp_v3.0_unigene48711

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Phospholipase D beta 1 isoform 1b n=3 Tax=Gossypium hirsutum RepID=Q8H1U1_GOSHI	-	-	3.0e-12	82%
FL-Next	sp=Phospholipase D; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	88%
Sma3	Phospholipase d beta, putative	-	-	2.022e-11	-

Source	ECs	Term	Type	e value	Identity
Sma3	Phospholipase D.	EC:3.1.4.4	-	4.2039e-45	-

Source	KEGGs	Term	e value	Identity
Sma3	Glycerophospholipid metabolism	00564	4.2039e-45	%
Sma3	Ether lipid metabolism	00565	4.2039e-45	%
Sma3	Metabolic pathways	01100	4.2039e-45	%

Source	Gene names
Sma3	A_IG005I10.13; At2g42010; At4g00240; At4g11830; At4g11840; At4g11850; At4g35790; F4B14.60; F5I10.13; GSVIVT00001073001; GSVIVT00007835001; GSVIVT00015517001; GSVIVT00026323001; GSVIVT00035483001; LOC_Os03g02740; LOC_Os03g62410; LOC_Os10g38060; OJ1263H11.7

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	cytosolic ribosome	GO:0022626	Cellular Component	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	phospholipase D activity	GO:0004630	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	NAPE-specific phospholipase D activity	GO:0070290	Molecular Function	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	defense response to bacterium, incompatible interaction	GO:0009816	Biological Process	-
Sma3	programmed cell death	GO:0012501	Biological Process	-
Sma3	lipid catabolic process	GO:0016042	Biological Process	-
Sma3	phosphatidylcholine metabolic process	GO:0046470	Biological Process	-
Sma3	phosphatidic acid metabolic process	GO:0046473	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	C2 calcium-dependent membrane targeting	IPR000008	-	-
Sma3	Phospholipase D/Transphosphatidylase	IPR001736	-	-
Sma3	Adenosine/AMP deaminase active site	IPR006650	-	-
Sma3	Phospholipase D, plant	IPR011402	-	-
Sma3	Phospholipase D	IPR015679	-	-
Sma3	C2 membrane targeting protein	IPR018029	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G42010.1	PLDBETA1, PLDBETA phospholipase D beta 1 chr2:17533018-17537990 REVERSE LENGTH=1083	3.0e-16	86%
RefSeq	Arabidopsis thaliana	NP_565963.2	phospholipase D [Arabidopsis thaliana]	3.0e-16	86%
RefSeq	Populus trichocarpa	XP_002320087.1	predicted protein [Populus trichocarpa]	3.0e-16	88%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LQ49

Fln msg: Distance to subject end: 275 aas, your sequence is shorter than subject: 46 - 861

Fln protein: CVPPLRERAPVVDMSIHTAYVEAIRSAQHFIYIENQYFIGSSYNWS

Protein Length: 47

Fln nts: GGTGTGTGCCTCCACTCCGAGAGCGAGCTCCGGTTGTGGACATGAGCATACATACAGCATATGTTGAAGCCATTCGATCTGCACAGCACTTCATTTATATTGAAAACCAATACTTCATTGGGTCATCATACAATTGGTCTGC

Fln Alignment:

CL13724Contig1___VVDMSIHTAYVEAIRSAQHFIYIENQYFIGSSYNW
B8LQ49_______________LVDKSIHTAYVKAIRSAQHFIYIENQYFVGSSYNW

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain