UniGene Name: sp_v3.0_unigene48680
Length: 125 nt
UniGene Fasta |
---|
>sp_v3.0_unigene48680
A |
Ace file of the UniGene sp_v3.0_unigene48680 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial; Short=FGAM synthase; Short=FGAMS; AltName: Full=Formylglycinamide ribotide amidotransferase; Short=FGARAT; AltName: Full=Formylglycinamide ribotide synthetase; | - | - | 5.0e-08 | 80% |
FL-Next | sp=Probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 80% |
Sma3 | Phosphoribosylformylglycinamidine synthase, putative | - | - | 2.447e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoribosylformylglycinamidine synthase. | EC:6.3.5.3 | - | 4.026e-16 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 4.026e-16 | % | |
Sma3 | Metabolic pathways | 01100 | 4.026e-16 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.026e-16 | % |
Source | Gene names |
---|---|
Sma3 | At1g74260; B1099D03.28; F1O17.7; FGAM1; FGAM2; OsI_04723; OsI_18107; OsJ_04346; OsJ_16802; P0434C04.48; PHYPADRAFT_172846; POPTRDRAFT_882858; RCOM_0246180; RCOM_1480330; pur4; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | phosphoribosylformylglycinamidine synthase activity | GO:0004642 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | 'de novo' IMP biosynthetic process | GO:0006189 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | AIR synthase-related protein | IPR000728 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Phosphoribosylformylglycinamidine synthase | IPR010073 | - | 0.0 | - |
Sma3 | AIR synthase-related protein, C-terminal | IPR010918 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Glutamine amidotransferase type 1 | IPR017926 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G74260.1 | PUR4 purine biosynthesis 4 chr1:27923005-27927764 REVERSE LENGTH=1407 | 6.0e-12 | 80% |
RefSeq | Arabidopsis thaliana | NP_177566.3 | phosphoribosylformylglycinamidine synthase [Arabidopsis thaliana] | 7.0e-12 | 80% |
RefSeq | Populus trichocarpa | XP_002315209.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-13 | 85% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9M8D3
Fln msg: Distance to subject end: 1186 aas, your sequence is shorter than subject: 41 - 1407
Fln protein:
F
Protein Length:
42
Fln nts:
A
Fln Alignment:
CL13378Contig1___FTTAWSANAVSICKACTLTEVTRIERSRRYLLCLK
Q9M8D3_______________FTTAWSTNAVSICRACGLDEVTRLERSRRYLLFSK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain