|
||||||
|
UniGene Name: sp_v3.0_unigene48652
Length: 203 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene48652
G |
|
Ace file of the UniGene sp_v3.0_unigene48652
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peptide transporter, putative n=1 Tax=Ricinus communis RepID=B9S7C1_RICCO | - | - | 3.0e-28 | 83% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Sma3 | POT family protein, expressed | - | - | 3.708e-17 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT3G54140; At1g22550; At1g22570; At1g62200; At2g02020; At2g02040; At3g54140; At5g01180; B1026C12.10; B1377B10.10; CHLREDRAFT_136180; F12K8.11; F12K8.8; F14H20.11; F19K23.13; F24B22.100; F7J8_160; GSVIVT00001844001; GSVIVT00020319001; GSVIVT00021470001; GS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | high affinity oligopeptide transporter activity | GO:0015334 | Molecular Function | 0.0 | - |
| Sma3 | dipeptide transporter activity | GO:0042936 | Molecular Function | 0.0 | - |
| Sma3 | tripeptide transporter activity | GO:0042937 | Molecular Function | 0.0 | - |
| Sma3 | oligopeptide transport | GO:0006857 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Sma3 | dipeptide transport | GO:0042938 | Biological Process | 0.0 | - |
| Sma3 | tripeptide transport | GO:0042939 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oligopeptide transporter | IPR000109 | - | 0.0 | - |
| Sma3 | PTR2 family proton/oligopeptide symporter, conserved site | IPR018456 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G02040.1 | ATPTR2-B, NTR1, PTR2-B, PTR2, ATPTR2 peptide transporter 2 chr2:487542-489707 FORWARD LENGTH=585 | 2.0e-32 | 77% |
| RefSeq | Arabidopsis thaliana | NP_178313.1 | peptide transporter PTR2 [Arabidopsis thaliana] | 2.0e-32 | 77% |
| RefSeq | Populus trichocarpa | XP_002315835.1 | predicted protein [Populus trichocarpa] | 7.0e-34 | 79% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVR2
Fln msg: Distance to subject end: 463 aas, your sequence is shorter than subject: 67 - 594
Fln protein:
C
Protein Length:
68
Fln nts:
G
Fln Alignment:
CL13050Contig1___CERLAFYGINTNLVTYLTKSLHQGNAAAAKSVTTWAGTCYVTPLLGAVLADAYWGRYWTIAAFSTIY
A9NVR2_______________CERLAYYGINTNLVTYLTKRLHQGNAAAAKSVTTWAGTCYLTPLFGAVLADAYWGRYWTIAAFSTIY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
