|
||||||
|
UniGene Name: sp_v3.0_unigene48600
Length: 210 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene48600
A |
|
Ace file of the UniGene sp_v3.0_unigene48600 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | [RTKL] COG0515 Serine/threonine protein kinase | - | - | 7.0e-08 | 43% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
| Sma3 | Chromosome chr12 scaffold_18, whole genome shotgun sequence | - | - | 1.561e-15 | - |
| Source | Gene names |
|---|---|
| Sma3 | 17L07.5; AT4g00340; A_IG005I10.19; At2g19130; At4g32300; B1099D03.46; B1099D03.51; DUPR11.18; F5I10.19; GSVIVT00001735001; GSVIVT00014011001; GSVIVT00017302001; GSVIVT00018598001; GSVIVT00018599001; GSVIVT00018786001; GSVIVT00018787001; GSVIVT00018788001; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | phospholipase C activity | GO:0004629 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G19130.1 | S-locus lectin protein kinase family protein chr2:8293789-8296275 FORWARD LENGTH=828 | 4.0e-22 | 55% |
| RefSeq | Arabidopsis thaliana | NP_179503.1 | S-locus lectin protein kinase-like protein [Arabidopsis thaliana] | 5.0e-22 | 55% |
| RefSeq | Populus trichocarpa | XP_002304900.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-24 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 136 aas, your sequence is shorter than subject: 69 - 431
Fln protein:
E
Protein Length:
70
Fln nts:
A
Fln Alignment:
CL12399Contig1___EQCREAIMHLDIKPQNILLDTKFNPKVSDFGMSKLLNNDM-TQVITAVRGTPGYLAPEWLHYTIATKKCD
A9NM60_______________EESRLCILHLDVKPQNILVDEYFKAKVSDFGMARCLKRDIESHLVTGVRGTPGYMAPEWLLGAGITSKSD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
