UniGene Name: sp_v3.0_unigene48519
Length: 171 nt
![]() |
---|
>sp_v3.0_unigene48519
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9SIT7.1|PP151_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g13600 gb|AAD22682.1| hypothetical protein [Arabidopsis thaliana] gb|AEC06244.1| pentatricopeptide repe | - | - | 3.0e-14 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Pentatricopeptide, putative, expressed | - | - | 4.02e-09 | - |
Source | Gene names |
---|---|
Sma3 | At1g20230; At2g01510; At2g13600; At2g22070; At3g11460; At5g40410; At5g48910; At5g59600; F24K9.13; F2I9.13; F2O15.13; GSVIVT00000138001; GSVIVT00000282001; GSVIVT00002423001; GSVIVT00003321001; GSVIVT00006467001; GSVIVT00006516001; GSVIVT00006973001; GSVIV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G13600.1 | Pentatricopeptide repeat (PPR) superfamily protein chr2:5671493-5673586 FORWARD LENGTH=697 | 4.0e-19 | 60% |
RefSeq | Arabidopsis thaliana | NP_178983.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 6.0e-19 | 60% |
RefSeq | Populus trichocarpa | XP_002298341.1 | predicted protein [Populus trichocarpa] | 2.0e-18 | 66% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AD86
Fln msg: Distance to subject end: 194 aas, your sequence is shorter than subject: 56 - 514
Fln protein:
H
Protein Length:
57
Fln nts:
G
Fln Alignment:
CL10825Contig1___YFNLMIQEYCIIPRADHYACMVDLLGRAGFLDEAKEFINYMPIEPDAVVWGALLG
D5AD86_______________YFNLMTQNYGIVPDVSHYTCMIDLLGRAGCLDEAENFINGMPVEPDVSVWGALLG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain