UniGene Name: sp_v3.0_unigene48400
Length: 180 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene48400
A |
Ace file of the UniGene sp_v3.0_unigene48400
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP binding protein, putative (EC:2.7.11.25) | - | - | 3.0e-17 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
| Sma3 | Chromosome chr12 scaffold_57, whole genome shotgun sequence | - | - | 1.051e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G53430; GSVIVT00031536001; GSVIVT00031541001; GSVIVT00031542001; GSVIVT00031549001; GSVIVT00035223001; GSVIVT00035234001; GSVIVT00035539001; GSVIVT00035549001; GSVIVT00035800001; LRR-RLK; OJ1014_H11.14; OSJNBa0093O08.2; Os04g0616400; Os08g0203400; OsI_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Chaperonin TCP-1, conserved site | IPR002194 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G53430.1 | Leucine-rich repeat transmembrane protein kinase chr1:19935298-19940959 FORWARD LENGTH=1030 | 7.0e-17 | 58% |
| RefSeq | Arabidopsis thaliana | NP_001117479.1 | Leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | 9.0e-17 | 58% |
| RefSeq | Populus trichocarpa | XP_002303698.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 67% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NS02
Fln msg: Distance to subject end: 50 aas, your sequence is shorter than subject: 60 - 315
Fln protein:
I
Protein Length:
61
Fln nts:
A
Fln Alignment:
CL9535Contig1___IPTTFANLKKMRVFWASSNNFTGNIPDFIGN-WSQLEDLKLEGSSFEGPIPSSISNLTKL
A9NS02_______________IPTTFSNLKKMRLFWASSNNFTGKIPDFIGNYWSQLENLKLEGTSFEGPIPLSISNLTNL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta