UniGene Name: sp_v3.0_unigene48389
Length: 215 nt
![]() |
---|
>sp_v3.0_unigene48389
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gb|AEC07931.1| Leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] | - | - | 2.0e-15 | 55% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 42% |
Source | Gene names |
---|---|
Sma3 | AT2G27060; At2g27060; GSVIVT00017368001; GSVIVT00019410001; GSVIVT00029756001; LOC_Os03g20450; LRR-RLK; OsI_11343; OsJ_10651; POPTRDRAFT_177494; POPTRDRAFT_562687; POPTRDRAFT_582582; POPTRDRAFT_782509; POPTRDRAFT_801003; VITISV_003240; VITISV_007077; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | phosphogluconate dehydrogenase (decarboxylating) activity | GO:0004616 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | 3-hydroxyisobutyrate dehydrogenase activity | GO:0008442 | Molecular Function | 0.0 | - |
Sma3 | pentose-phosphate shunt | GO:0006098 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | valine metabolic process | GO:0006573 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Intradiol ring-cleavage dioxygenase, C-terminal | IPR000627 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | 3-hydroxyisobutyrate dehydrogenase-related, conserved site | IPR002204 | - | 0.0 | - |
Sma3 | 6-phosphogluconate dehydrogenase, NADP-binding | IPR006115 | - | 0.0 | - |
Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G27060.1 | Leucine-rich repeat protein kinase family protein chr2:11551288-11554577 FORWARD LENGTH=1020 | 5.0e-20 | 55% |
RefSeq | Arabidopsis thaliana | NP_180274.2 | Leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] | 6.0e-20 | 55% |
RefSeq | Populus trichocarpa | XP_002328099.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 60% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LK76
Fln msg: Distance to subject end: 368 aas, your sequence is shorter than subject: 71 - 564
Fln protein:
D
Protein Length:
72
Fln nts:
G
Fln Alignment:
CL9421Contig1___DLSDNKLSGDLSM-MRTWGNYMEVLDLSQNSFTGSLPNDTSQFLRLTYLNLSHNNLVGSLP
B8LK76_______________DLSDNNLSGTIPVNLSKWLPYLTSLDLSQNNFHGSIPAEIANCTYLNIIHLQENQLSGEIP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain