UniGene Name: sp_v3.0_unigene48219
Length: 230 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene48219
A |
Ace file of the UniGene sp_v3.0_unigene48219 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Dimer_Tnp_hAT domain containing protein | - | - | 9.0e-08 | 39% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00000858001; GSVIVT00001200001; GSVIVT00002113001; GSVIVT00002367001; GSVIVT00005187001; GSVIVT00006112001; GSVIVT00010659001; GSVIVT00012114001; GSVIVT00017198001; GSVIVT00019208001; GSVIVT00019252001; GSVIVT00029960001; GSVIVT00034220001; GSVIVT00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | drug transmembrane transporter activity | GO:0015238 | Molecular Function | 0.0 | - |
Sma3 | antiporter activity | GO:0015297 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | drug transmembrane transport | GO:0006855 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 1 | IPR001360 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Multi antimicrobial extrusion protein | IPR002528 | - | 0.0 | - |
Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
Sma3 | Histidine triad motif | IPR011151 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G33406.1 | hAT dimerisation domain-containing protein / transposase-related chr5:12676126-12678403 REVERSE LENGTH=509 | 3.0e-15 | 58% |
RefSeq | Arabidopsis thaliana | NP_680299.4 | hAT family dimerization domain-containing protein [Arabidopsis thaliana] | 4.0e-15 | 58% |
RefSeq | Populus trichocarpa | XP_002302801.1 | predicted protein [Populus trichocarpa] | 3.0e-13 | 50% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A8W4
Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 153 aas, your sequence is shorter than subject: 58 - 478
Fln protein:
C
Protein Length:
59
Fln nts:
A
Fln Alignment:
CL7232Contig1___LVDAWWTSYGARVPHLQKLAIRVLSQTCSSSGCERNWSVFDKIHSKKCNR
D5A8W4_______________MFDTWWENYGATTPILQKMAIRVLSQTCSSSGCERNWSVFEKIHTKKRNR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain