SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene47997

Length: 404 nt

UniGene Fasta

>sp_v3.0_unigene47997
TAAAGATAAGAAATGGATAGAAGCTATGGATGAAGAAATGAATGCCATAGAGAGAAACAAGACATGGGATTTAGTTGAGCTACCAAAAGGTAAAGAAGTCATTGGAGTTAAATGGGTCTACAAGACCAAGAGTAATGCTGAATGCAAGATAGAAAGGCACAAGGCAAGACTTGTTGTCAAGAGATACAAGCAACAATATGGGAGAGACTATAAGGAAACTTTCGCACCGGTTGCAAGAATGGAAACCGTGAGAGAAATGTTGTCCATAGCAGCACAAAACAAATGGAAAGTTTACCAATTGGATGTGAAGTCAGCATTCCTAAATGGAGTGTTAATGGAAGAGGTTTATATTGAGAAACCTCTAGGCTATGAAAAGAAAAGCCAAGAGCACAAAGTGTGCAAAT

Ace file of the UniGene sp_v3.0_unigene47997

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	RVT_2 domain containing protein	-	-	0.0	56%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	62%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	2.086e-25	-

Source	Gene names
Sma3	60I2G14; At2g05390; At2g05960; At2g07010; At2g13940; At2g15650; At2g23330; At2g24660; B1003C08.12; B1065G12.28; B1110B01.4; F11I4_21; F28H19.6; H0512B01.3; H0512B01.8; LOC_Os03g05850; LOC_Os03g06540; LOC_Os03g20080; LOC_Os03g25890; LOC_Os03g28110; LOC_Os0

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	oxygen evolving complex	GO:0009654	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	extrinsic to membrane	GO:0019898	Cellular Component	-
Sma3	nucleotide binding	GO:0000166	Molecular Function	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	peptidase activity	GO:0008233	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	kinase activity	GO:0016301	Molecular Function	-
Sma3	phosphotransferase activity, alcohol group as acceptor	GO:0016773	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	photosynthesis	GO:0015979	Biological Process	-
Sma3	phosphorylation	GO:0016310	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	EGF-type aspartate/asparagine hydroxylation site	IPR000152	-	-
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	BTB/POZ-like	IPR000210	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Epidermal growth factor-like domain	IPR000742	-	-
Sma3	Peptidase M14, carboxypeptidase A	IPR000834	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	BRCT domain	IPR001357	-	-
Sma3	Bulb-type lectin domain	IPR001480	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	Ankyrin repeat	IPR002110	-	-
Sma3	Phosphotransferase system, HPr serine phosphorylation site	IPR002114	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Chaperonin TCP-1, conserved site	IPR002194	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Transcription factor GRAS	IPR005202	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	GHMP kinase N-terminal domain	IPR006204	-	-
Sma3	Mevalonate/galactokinase	IPR006206	-	-
Sma3	Epidermal growth factor-like	IPR006210	-	-
Sma3	Uncharacterised protein family Cys-rich	IPR006461	-	-
Sma3	Glutamine synthetase, catalytic domain	IPR008146	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Photosystem II PsbQ, oxygen evolving complex	IPR008797	-	-
Sma3		IPR010256	-	-
Sma3	CCT domain	IPR010402	-	-
Sma3	BTB/POZ fold	IPR011333	-	-
Sma3	BTB/POZ	IPR013069	-	-
Sma3		IPR013084	-	-
Sma3		IPR013091	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	PAN-2 domain	IPR013227	-	-
Sma3	ABC-2 type transporter	IPR013525	-	-
Sma3	GHMP kinase, C-terminal domain	IPR013750	-	-
Sma3	Ribosomal protein S5 domain 2-type fold, subgroup	IPR014721	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3	Acyl-CoA N-acyltransferase	IPR016181	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	EGF-like calcium-binding, conserved site	IPR018097	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	Heat shock protein DnaJ, conserved site	IPR018253	-	-
Sma3	Carbohydrate kinase, FGGY, conserved site	IPR018483	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G23160.1	CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262	6.0e-33	49%
RefSeq	Arabidopsis thaliana	NP_194047.2	cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana]	8.0e-33	49%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LKV8

Fln msg: Distance to subject end: 237 aas, your sequence is shorter than subject: 126 - 363

Fln protein: MDEEMNAIERNKTWDLVELPKGKEVIGVKWVYKTKSNAECKIERHKARLVVKRYKQQYGRDYKETFAPVARMETVREMLSIAAQNKWKVYQLDVKSAFLNGVLMEEVYIEKPLGYEKKSQEHKVCK

Protein Length: 127

Fln nts: TAAAGATAAGAAATGGATAGAAGCT_-_ATGGATGAAGAAATGAATGCCATAGAGAGAAACAAGACATGGGATTTAGTTGAGCTACCAAAAGGTAAAGAAGTCATTGGAGTTAAATGGGTCTACAAGACCAAGAGTAATGCTGAATGCAAGATAGAAAGGCACAAGGCAAGACTTGTTGTCAAGAGATACAAGCAACAATATGGGAGAGACTATAAGGAAACTTTCGCACCGGTTGCAAGAATGGAAACCGTGAGAGAAATGTTGTCCATAGCAGCACAAAACAAATGGAAAGTTTACCAATTGGATGTGAAGTCAGCATTCCTAAATGGAGTGTTAATGGAAGAGGTTTATATTGAGAAACCTCTAGGCTATGAAAAGAAAAGCCAAGAGCACAAAGTGTGCAAAT

Fln Alignment:

CL3839Contig1___MDEEMNAIERNKTWDLVELPKGKEVIGVKWVYKTKSNAECKIERHKARLVVKRYKQQYGRDYKETFAPVARMETVREMLSIAAQNKWKVYQLDVKSAFLNGVLMEEVYIEKPLGYEKKSQEHKV
B8LKV8_______________MNKEMESIKKNDTWDLVDLPKEKECISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVKSAFLNGYLEEEVYVQQPPRYEVRGQEDKV

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain