UniGene Name: sp_v3.0_unigene47435
Length: 140 nt
UniGene Fasta |
---|
>sp_v3.0_unigene47435
T |
Ace file of the UniGene sp_v3.0_unigene47435 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Bifunctional nitrilase/nitrile hydratase NIT4B; Short=TNIT4B; AltName: Full=Cyanoalanine nitrilase B; AltName: Full=Nitrilase 4B dbj|BAA11770.1| nitrilase [Nicotiana tabacum] | - | - | 4.0e-14 | 84% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
Sma3 | Nitrilase, putative | - | - | 1.385e-20 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Nitrilase. | EC:3.5.5.1 | - | 8.271e-33 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tryptophan metabolism | 00380 | 8.271e-33 | % | |
Sma3 | Cyanoamino acid metabolism | 00460 | 8.271e-33 | % | |
Sma3 | Aminobenzoate degradation | 00627 | 8.271e-33 | % | |
Sma3 | Styrene degradation | 00643 | 8.271e-33 | % | |
Sma3 | Nitrogen metabolism | 00910 | 8.271e-33 | % | |
Sma3 | Metabolic pathways | 01100 | 8.271e-33 | % | |
Sma3 | Cyanoalanine nitrilase. | EC:3.5.5.4 | - | 4.929e-12 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cyanoamino acid metabolism | 00460 | 4.929e-12 | % |
Source | Gene names |
---|---|
Sma3 | At3g44300; At5g22300; GSVIVT00003612001; GSVIVT00003674001; GSVIVT00003679001; GSVIVT00003683001; GSVIVT00003685001; GSVIVT00003689001; GSVIVT00003691001; GSVIVT00003693001; GSVIVT00003699001; GSVIVT00003701001; GSVIVT00037300001; LOC_Os02g42350; MWD9.8; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | nitrilase activity | GO:0000257 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds | GO:0016810 | Molecular Function | 0.0 | - |
Sma3 | nitrile hydratase activity | GO:0018822 | Molecular Function | 0.0 | - |
Sma3 | cyanoalanine nitrilase activity | GO:0047427 | Molecular Function | 0.0 | - |
Sma3 | 3-cyanoalanine hydratase activity | GO:0047558 | Molecular Function | 0.0 | - |
Sma3 | nitrogen compound metabolic process | GO:0006807 | Biological Process | 0.0 | - |
Sma3 | indoleacetic acid biosynthetic process | GO:0009684 | Biological Process | 0.0 | - |
Sma3 | cyanide metabolic process | GO:0019499 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | detoxification of nitrogen compound | GO:0051410 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Nitrilase/cyanide hydratase, conserved site | IPR000132 | - | 0.0 | - |
Sma3 | Nitrilase/cyanide hydratase | IPR003010 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G22300.1 | NIT4, AtNIT4 nitrilase 4 chr5:7379401-7381764 FORWARD LENGTH=355 | 6.0e-18 | 83% |
RefSeq | Arabidopsis thaliana | NP_197622.1 | bifunctional nitrilase/nitrile hydratase NIT4 [Arabidopsis thaliana] | 8.0e-18 | 83% |
RefSeq | Populus trichocarpa | XP_002328237.1 | nitrilase 1 [Populus trichocarpa] | 2.0e-19 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLF1
Fln msg: Distance to subject end: 112 aas, your sequence is shorter than subject: 46 - 191
Fln protein:
F
Protein Length:
47
Fln nts:
T
Fln Alignment:
CL19910Contig1___FYDTPATLDKAERLIAEGAACGSQLFVFPEAFIGGYPRGSSFGVVM
B8LLF1_______________FYDTPATVEKAERLIAEGAAYGSQLLVFPEAFIGGYPRGSNFGVVM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain