|
||||||
|
UniGene Name: sp_v3.0_unigene47323
Length: 231 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene47323
C |
|
Ace file of the UniGene sp_v3.0_unigene47323 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Cycas revoluta RepID=Q4JQ45_CYCRE | - | - | 4.0e-19 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
| Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 8.057e-33 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g05390; At2g05960; B1110B01.4; F11I4_21; F28H19.6; GagPol1; H0512B01.8; H0716A07.9; LOC_Os03g05850; LOC_Os03g21050; LOC_Os03g22100; LOC_Os03g28110; LOC_Os03g31134; LOC_Os03g33640; LOC_Os03g41000; LOC_Os03g43610; LOC_Os03g44280; LOC_Os03g44940; LOC_Os03 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | GPI anchor biosynthetic process | GO:0006506 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 232 aas, your sequence is shorter than subject: 64 - 363
Fln protein:
Q
Protein Length:
65
Fln nts:
C
Fln Alignment:
CL18534Contig1___QKEGVDYEETFAPKTKWATIRTLFALATQNGWKVHKMDVKIAFLNGDLKENVFMSQP
B8LKV8_______________QEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVKSAFLNGYLEEEVYVQQP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
