UniGene Name: sp_v3.0_unigene47224
Length: 233 nt
UniGene Fasta |
---|
>sp_v3.0_unigene47224
A |
Ace file of the UniGene sp_v3.0_unigene47224 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | protein phosphatase 2C [Medicago sativa] | - | - | 7.0e-23 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | Protein phosphatase 2c, putative | - | - | 7.348e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoprotein phosphatase. | EC:3.1.3.16 | - | 5.781e-18 | - |
Source | Gene names |
---|---|
Sma3 | ACRE284; AP3_H09.2; At1g07160; At1g67820; At2g30020; At2g40180; F10K1.13; F12A21.5; F23F1.6; GSVIVT00024072001; GSVIVT00029318001; GSVIVT00030762001; GSVIVT00032073001; LOC_Os03g18150; LOC_Os11g13820; LOC_Os12g09640; MP2C; NbP2C; Os03g0292100; Os11g024220 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | protein serine/threonine phosphatase complex | GO:0008287 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine phosphatase activity | GO:0004722 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | protein dephosphorylation | GO:0006470 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein phosphatase 2C, manganese/magnesium aspartate binding site | IPR000222 | - | 0.0 | - |
Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Protein of unknown function DUF868, plant | IPR008586 | - | 0.0 | - |
Sma3 | IPR014045 | - | 0.0 | - | |
Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G07160.1 | Protein phosphatase 2C family protein chr1:2198155-2199678 REVERSE LENGTH=380 | 4.0e-28 | 67% |
RefSeq | Arabidopsis thaliana | NP_172196.1 | putative protein phosphatase 2C 2 [Arabidopsis thaliana] | 5.0e-28 | 67% |
RefSeq | Populus trichocarpa | XP_002311236.1 | predicted protein [Populus trichocarpa] | 5.0e-31 | 69% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKN4
Fln msg: Distance to subject end: 116 aas, your sequence is shorter than subject: 77 - 449
Fln protein:
R
Protein Length:
78
Fln nts:
A
Fln Alignment:
CL17229Contig1___RAGYLKTDAEFLKQNVSGGTACATALIIDGNLVVSNAGDCRAVISRNGSSEALTCDHQAGREDERQRIESLGGIVDL
B8LKN4_______________RAGYLTTDAEFLKQEVGSGTACVTALIIDGNLVVSNAGDCRAVISRDGASEALTCDHRAGREDERQRIENLGGIVDL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain