UniGene Name: sp_v3.0_unigene46983
Length: 144 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene46983
T |
Ace file of the UniGene sp_v3.0_unigene46983
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Anthranilate phosphoribosyltransferase-like protein n=4 Tax=BEP clade RepID=Q69T22_ORYSJ | - | - | 6.0e-17 | 82% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 74% |
| Sma3 | Synaptotagmin, putative | - | - | 1.15e-20 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G22610; AT4g20080; At1g04150; At1g22610; At1g51570; At1g74720; At3g03680; At3g57880; At4g20080; At5g06850; At5g12970; At5g17980; At5g48060; F12K8.4; F19C24.20; F1M20.40; F20D22.8; F25A4.30; GSVIVT00000095001; GSVIVT00000407001; GSVIVT00003833001; GSVIV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | glutathione peroxidase activity | GO:0004602 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
| Sma3 | Glutathione peroxidase | IPR000889 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Molybdopterin oxidoreductase, prokaryotic, conserved site | IPR006655 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF1118 | IPR009500 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | Phosphoribosyltransferase C-terminal | IPR013583 | - | 0.0 | - |
| Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
| Sma3 | Hemopexin/matrixin, conserved site | IPR018486 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G57880.1 | Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein chr3:21431198-21433519 REVERSE LENGTH=773 | 6.0e-21 | 78% |
| RefSeq | Arabidopsis thaliana | NP_191347.1 | calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like protein [Arabidopsis thaliana] | 8.0e-21 | 78% |
| RefSeq | Populus trichocarpa | XP_002298449.1 | predicted protein [Populus trichocarpa] | 1.0e-21 | 80% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LL63
Fln msg: Distance to subject end: 373 aas, your sequence is shorter than subject: 47 - 758
Fln protein:
W
Protein Length:
48
Fln nts:
T
Fln Alignment:
CL14890Contig1___WKPPVGVLEVGILGAKNLVPIKSKDGRGVTDAYCVAKYGQKWIRTRT
B8LL63_______________WKSYIGILQVGILSAQNLLPMKTKDGRGTTDAYCVAKYGQKWVRTRT

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta