UniGene Name: sp_v3.0_unigene46411
Length: 210 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene46411
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA-directed RNA polymerase (Fragment) n=1 Tax=Ginkgo biloba RepID=Q1L6W2_GINBI | - | - | 9.0e-31 | 86% |
FL-Next | sp=DNA-directed RNA polymerase subunit beta; Podocarpus totara. Plastid; Chloroplast. | - | - | 0.0 | 36% |
Sma3 | DNA-directed RNA polymerase | - | - | 9.572e-33 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase. | EC:2.7.7.6 | - | 3.157e-30 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 3.157e-30 | % | |
Sma3 | Pyrimidine metabolism | 00240 | 3.157e-30 | % | |
Sma3 | Metabolic pathways | 01100 | 3.157e-30 | % |
Source | Gene names |
---|---|
Sma3 | At3g18090; At3g23780; B0414F07.4; EMB1989; GSVIVT00018575001; GSVIVT00032775001; LOC_Os03g44484; MICPUCDRAFT_31670; MICPUN_93697; NRPD2a; OJ1590_E05.24; OSJNBa0063C18.1; OSJNBb0079B02.6; OSTLU_13673; Os03g0646800; Os04g0641000; Os08g0171600; OsI_12811; Os |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase IV complex | GO:0000418 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nuclear heterochromatin | GO:0005720 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
Sma3 | ribonucleoside binding | GO:0032549 | Molecular Function | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | GO:0006350 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed RNA polymerase, subunit 2, domain 6 | IPR007120 | - | 0.0 | - |
Sma3 | RNA polymerase, beta subunit, conserved site | IPR007121 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 7 | IPR007641 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 2 | IPR007642 | - | 0.0 | - |
Sma3 | RNA polymerase, beta subunit, protrusion | IPR007644 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 3 | IPR007645 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 4 | IPR007646 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, domain 5 | IPR007647 | - | 0.0 | - |
Sma3 | RNA polymerase Rpb2, OB-fold | IPR014724 | - | 0.0 | - |
Sma3 | DNA-directed RNA polymerase, subunit 2 | IPR015712 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G23780.1 | NRPD2A, DRD2, NRPD2, DMS2, NRPE2 nuclear RNA polymerase D2A chr3:8567971-8573819 REVERSE LENGTH=1172 | 5.0e-29 | 68% |
RefSeq | Arabidopsis thaliana | NP_001189957.1 | nuclear RNA polymerase D2A [Arabidopsis thaliana] | 6.0e-29 | 68% |
RefSeq | Populus trichocarpa | XP_002324332.1 | predicted protein [Populus trichocarpa] | 6.0e-27 | 65% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: G8HSW7
Fln msg: Distance to subject end: 94 aas, your sequence is shorter than subject: 70 - 1089
Fln protein:
S
Protein Length:
71
Fln nts:
T
Fln Alignment:
CL7581Contig1___GKEQMYNGRTGGKMQTRIFVGPTYYQRLIHMAEDKIKYRNHGPVHPLTRQPVADR
G8HSW7_______________GKHRLIDGRTGEVFEQPVTIGIAYMSKLCHQVDDKIHARSSGPYARVTQQPLKGR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain