UniGene Name: sp_v3.0_unigene46236
Length: 197 nt
UniGene Fasta |
---|
>sp_v3.0_unigene46236
G |
Ace file of the UniGene sp_v3.0_unigene46236 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pfam04770, ZF-HD_dimer, ZF-HD protein dimerisation region | - | - | 4.0e-32 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Sma3 | ZF-HD homeobox protein | - | - | 9.06e-26 | - |
Source | Gene names |
---|---|
Sma3 | 10A19I.6; 49D11.22; At1g14440; At1g69600; At1g74660; At1g75240; At2g02540; At2g18350; At3g28917; At3g28920; At3g50890; At4g24660; At5g15210; At5g39760; At5g42780; At5g65410; F14L17.21; F18B3.170; F1M20.34; F22H5.4; F22K18.140; F24J1.29; F8M21_100; GSVIVT0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | photomorphogenesis | GO:0009640 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to cytokinin stimulus | GO:0009735 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to brassinosteroid stimulus | GO:0009741 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
Sma3 | Homeodomain | IPR001356 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Homeodomain, ZF-HD class | IPR006455 | - | 0.0 | - |
Sma3 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain | IPR006456 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G24660.1 | ATHB22, MEE68, HB22, ZHD2 homeobox protein 22 chr4:12724851-12725513 REVERSE LENGTH=220 | 2.0e-27 | 82% |
RefSeq | Arabidopsis thaliana | NP_194197.1 | ZF-HD homeobox protein [Arabidopsis thaliana] | 3.0e-27 | 82% |
RefSeq | Populus trichocarpa | XP_002325543.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-27 | 83% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAI2
Fln msg: Distance to subject end: 156 aas, your sequence is shorter than subject: 65 - 283
Fln protein:
E
Protein Length:
66
Fln nts:
G
Fln Alignment:
CL4374Contig1___KPRSVKYRECLKNHAASIGGHANDGCGEFMPSGDEGTLEALKCAACGCHRNFHR
D5AAI2_______________KPRSVKYRECLKNHAASIGGHANDGCGEFMPSGDEGTLEALKCAACGCHRNFHR
SSRs (tot: 1) |
---|
Start position | End position | Sequence | Length |
---|---|---|---|
3 | 19 | GGC GGC GGC GGC GGC GG | 17 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain