UniGene Name: sp_v3.0_unigene45284
Length: 194 nt
![]() |
---|
>sp_v3.0_unigene45284
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pleiotropic drug resistance protein TUR2 n=1 Tax=Spirodela polyrhiza RepID=TUR2_SPIPO | - | - | 3.0e-18 | 65% |
FL-Next | sp=Pleiotropic drug resistance protein TUR2; Spirodela polyrrhiza (Giant duckweed). | - | - | 0.0 | 65% |
Sma3 | ATP-binding cassette transporter, putative | - | - | 6.07e-33 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 7.539e-28 | - |
Sma3 | Polyamine-transporting ATPase. | EC:3.6.3.31 | - | 1.348e-06 | - |
Source | Gene names |
---|---|
Sma3 | At1g15520; At1g66950; At2g36380; F1O11.1; F1O19.3; GSVIVT00019708001; GSVIVT00021655001; GSVIVT00022062001; GSVIVT00034321001; GSVIVT00034494001; GSVIVT00034944001; GSVIVT00034957001; LOC_Os01g42350; LOC_Os02g11760; LOC_Os06g36090; LOC_Os07g33780; OJ1003_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
Sma3 | lead ion transport | GO:0015692 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G36380.1 | PDR6, ATPDR6 pleiotropic drug resistance 6 chr2:15257583-15263627 FORWARD LENGTH=1453 | 2.0e-21 | 57% |
RefSeq | Arabidopsis thaliana | NP_181179.2 | ABC transporter G family member 34 [Arabidopsis thaliana] | 2.0e-21 | 57% |
RefSeq | Populus trichocarpa | XP_002311035.1 | predicted protein [Populus trichocarpa] | 9.0e-22 | 57% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O24367
Fln msg: Distance to subject end: 897 aas, your sequence is shorter than subject: 64 - 1441
Fln protein:
S
Protein Length:
65
Fln nts:
T
Fln Alignment:
CL15885Contig1___EELSHPYDRKKSHPAALTSSKYGVSKMNIFKACFAREWLLIKRNSFVYIFKTGQIVVVGILTM
O24367_______________EELSTPFDRSRNHPAALTTSKYGISKMELLKACIDREWLLMKRNSFVYIFKVVQLIVLALIAM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain