UniGene Name: sp_v3.0_unigene45106
Length: 222 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene45106
G |
Ace file of the UniGene sp_v3.0_unigene45106
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RI14_RICCO | - | - | 1.0e-22 | 69% |
| FL-Next | sp=Probable LRR receptor-like serine/threonine-protein kinase At1g56140; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 63% |
| Sma3 | Putative Receptor-like serine/threonine kinase(RFK1) | - | - | 1.659e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G53420; AT1G56145; At1g56140; At1g56145; F14G9.24; F1N18.22; GSVIVT00011117001; GSVIVT00018818001; GSVIVT00027888001; GSVIVT00027893001; GSVIVT00027895001; GSVIVT00027899001; GSVIVT00027903001; GSVIVT00031536001; GSVIVT00031537001; GSVIVT00031542001; G |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | metal ion transmembrane transporter activity | GO:0046873 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G56120.1 | Leucine-rich repeat transmembrane protein kinase chr1:20987288-20993072 REVERSE LENGTH=1047 | 2.0e-25 | 64% |
| RefSeq | Arabidopsis thaliana | NP_176008.4 | Leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | 3.0e-25 | 64% |
| RefSeq | Populus trichocarpa | XP_002309634.1 | predicted protein [Populus trichocarpa] | 8.0e-27 | 63% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: C0LGH3
Fln msg: Distance to subject end: 466 aas, your sequence is shorter than subject: 74 - 1033
Fln protein:
E
Protein Length:
75
Fln nts:
G
Fln Alignment:
CL14013Contig1___ESSLYQTARLSASSLRYYGLGLENGQYTVKLLFAEIQFL--DTSIWQTIGRRVFDVYIQGQKVLTDFDIRKEAGGS
C0LGH3_______________DSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWRGLGRRRFDIYVQGRLVEKDFDVRRTAGDS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta