UniGene Name: sp_v3.0_unigene45001
Length: 151 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene45001
G |
Ace file of the UniGene sp_v3.0_unigene45001 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pleiotropic drug resistance protein 2 n=1 Tax=Nicotiana plumbaginifolia RepID=PDR2_NICPL | - | - | 2.0e-10 | 88% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Sma3 | ATP-binding cassette transporter, putative | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 1.4013e-45 | - |
| Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 1.187e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | ABC1; At1g15210; At1g15520; At1g59870; At1g66950; At2g26910; At2g29940; At2g36380; At2g37280; At3g16340; At3g30842; At3g53480; At4g15215; At4g15220/At4g15230; At4g15233; At4g15236; B1045F02.15; B1090H08.39; CHLREDRAFT_103211; CHLREDRAFT_115842; CHLREDRAFT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | cadmium ion transmembrane transporter activity | GO:0015086 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus, incompatible interaction | GO:0009817 | Biological Process | 0.0 | - |
| Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
| Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
| Sma3 | lead ion transport | GO:0015692 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of defense response | GO:0031348 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G29940.1 | PDR3, ATPDR3 pleiotropic drug resistance 3 chr2:12760139-12766455 FORWARD LENGTH=1426 | 3.0e-14 | 88% |
| RefSeq | Arabidopsis thaliana | NP_180555.2 | ABC transporter G family member 31 [Arabidopsis thaliana] | 4.0e-14 | 88% |
| RefSeq | Populus trichocarpa | XP_002311035.1 | predicted protein [Populus trichocarpa] | 4.0e-14 | 88% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPF4
Fln msg: Distance to subject end: 64 aas, your sequence is shorter than subject: 50 - 283
Fln protein:
A
Protein Length:
51
Fln nts:
G
Fln Alignment:
CL12849Contig1___DTGRTVVCTIHQPSIDIFDAFDELLLMKLRGEVIY
B8LPF4_______________DTGRTVVCTIHQPSVDIFEAFDELLLMKQGGQIIY

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)