UniGene Name: sp_v3.0_unigene44994
Length: 156 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene44994
A |
Ace file of the UniGene sp_v3.0_unigene44994
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone n=2 Tax=Populus trichocarpa RepID=B9MWR7_POPTR | - | - | 3.0e-13 | 69% |
| FL-Next | tr=Cytochrome P450 90A20; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
| Sma3 | Cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone | - | - | 5.891e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ent-kaurenoic acid oxidase. | EC:1.14.13.79 | - | 8.006e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 8.006e-07 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 8.006e-07 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 8.006e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 8.006e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.006e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | AP22.10; At4g36380; C7A10.980; CYP90C1; CYP90D2; CYP90D5; CYP90D6; D2; F23E13.220; GSVIVT00034159001; LOC_Os01g10040; Os01g0197100; OsI_00765; P0419B01.11; POPTRDRAFT_678468; POPTRDRAFT_703918; POPTRDRAFT_802964; RCOM_0312700; RCOM_0533200; ROT3; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen | GO:0016709 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid homeostasis | GO:0010268 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid biosynthetic process | GO:0016132 | Biological Process | 0.0 | - |
| Sma3 | monopolar cell growth | GO:0042814 | Biological Process | 0.0 | - |
| Sma3 | petal development | GO:0048441 | Biological Process | 0.0 | - |
| Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G36380.1 | ROT3 Cytochrome P450 superfamily protein chr4:17187973-17192202 REVERSE LENGTH=524 | 1.0e-14 | 62% |
| RefSeq | Arabidopsis thaliana | NP_568002.1 | 3-epi-6-deoxocathasterone 23-monooxygenase [Arabidopsis thaliana] | 2.0e-14 | 62% |
| RefSeq | Populus trichocarpa | XP_002327539.1 | cytochrome P450 probable 6-deoxoteasterone to 3-dehydro 6-deoxoteasterone or teasterone to 3-dehydro teasterone [Populus trichocarpa] | 2.0e-18 | 69% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWM7
Fln msg: Distance to subject end: 342 aas, your sequence is shorter than subject: 51 - 487
Fln protein:
P
Protein Length:
52
Fln nts:
A
Fln Alignment:
CL12788Contig1___PEVSKVVMQNDGRIFVPSYPKSLNELMGKSSILMLTGNLQKKLHGLIGGF
A9NWM7_______________PEVNKFILQNEGKLFATSYPSSITNLLGKHSLLLIQGNLHKRLHSLTLSF

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta