UniGene Name: sp_v3.0_unigene43949
Length: 176 nt
UniGene Fasta |
---|
>sp_v3.0_unigene43949
C |
Ace file of the UniGene sp_v3.0_unigene43949 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Leucine-rich repeat transmembrane protein kinase n=1 Tax=Glycine max RepID=C6ZRZ9_SOYBN | - | - | 9.0e-13 | 64% |
FL-Next | tr=Receptor protein kinase; Pinus sylvestris (Scots pine). | - | - | 0.0 | 41% |
Sma3 | Leucine Rich Repeat family protein | - | - | 2.589e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT1G34110; AT5G48940; At3g24240; DUPR11.16; F12G12.7; GSVIVT00005395001; K13K6.1; LOC_Os10g33080; LOC_Os10g33110; LOC_Os10g33130; LOC_Os11g10310; LOC_Os11g46980; LRR-RLK; OSJNBa0079L16.21; OSJNBa0079L16.3; OSJNBa0079L16.5; OSJNBa0095H06.6; Os04g0132500; O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | interspecies interaction between organisms | GO:0044419 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G34110.1 | Leucine-rich receptor-like protein kinase family protein chr1:12417331-12421246 REVERSE LENGTH=1072 | 1.0e-16 | 60% |
RefSeq | Arabidopsis thaliana | NP_174673.3 | leucine-rich receptor-like protein kinase [Arabidopsis thaliana] | 2.0e-16 | 60% |
RefSeq | Populus trichocarpa | XP_002302156.1 | predicted protein [Populus trichocarpa] | 1.0e-16 | 58% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9FEU2
Fln msg: Distance to subject end: 519 aas, your sequence is shorter than subject: 58 - 1145
Fln protein:
T
Protein Length:
59
Fln nts:
C
Fln Alignment:
CL22101Contig1___TNLTGVLPPDLGDLIQLEVLDLSGNSLTGPIPLQLGRLTQLQVLYLNSNQLEGSIPPE
Q9FEU2_______________TNISGKIPLSFGSLKKLQTLAIYTAFLSGTIPAELGNCSELVNLYLYENRLSGAIPRE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain