UniGene Name: sp_v3.0_unigene43877
Length: 140 nt
UniGene Fasta |
---|
>sp_v3.0_unigene43877
T |
Ace file of the UniGene sp_v3.0_unigene43877 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protein translocase subunit secA n=1 Tax=Arabidopsis thaliana RepID=Q9XI14_ARATH | - | - | 2.0e-14 | 84% |
FL-Next | Isoform 2 of Protein translocase subunit SECA2, chloroplastic OS=Arabidopsis thaliana GN=SECA2 | - | - | 0.0 | 84% |
Sma3 | Protein translocase subunit secA | - | - | 5.418e-29 | - |
Source | Gene names |
---|---|
Sma3 | F8K7.6; GSVIVT00015443001; LOC_Os11g08980; Os01g0321300; Os11g0195100; OsI_01632; OsI_25593; OsJ_01526; OsJ_33268; P0426D06.18; PHYPADRAFT_154523; POPTRDRAFT_551406; RCOM_0562390; secA; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein targeting | GO:0006605 | Biological Process | 0.0 | - |
Sma3 | protein import | GO:0017038 | Biological Process | 0.0 | - |
Sma3 | intracellular protein transmembrane transport | GO:0065002 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SecA protein | IPR000185 | - | 0.0 | - |
Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | SecA DEAD-like, N-terminal | IPR011115 | - | 0.0 | - |
Sma3 | SecA Wing/Scaffold | IPR011116 | - | 0.0 | - |
Sma3 | SecA preprotein, cross-linking domain | IPR011130 | - | 0.0 | - |
Sma3 | SecA motor DEAD | IPR014018 | - | 0.0 | - |
Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Sma3 | IPR019782 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G21650.3 | SECA2 Preprotein translocase SecA family protein chr1:7592891-7604152 REVERSE LENGTH=1805 | 2.0e-19 | 84% |
RefSeq | Arabidopsis thaliana | NP_173584.5 | preprotein translocase secA-like protein [Arabidopsis thaliana] | 2.0e-19 | 84% |
RefSeq | Populus trichocarpa | XP_002300961.1 | predicted protein [Populus trichocarpa] | 3.0e-19 | 84% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: D8WUA4-2
Fln msg: Distance to subject end: 503 aas, your sequence is shorter than subject: 46 - 1051
Fln protein:
A
Protein Length:
47
Fln nts:
T
Fln Alignment:
CL21219Contig1___GTTSVEHAEYLSELLSEWDIPHNVLNARPKYAAREAQIVAQAGRK
D8WUA4-2_____________GTTSVENSEYLSELLKEWGIPHNVLNARPKYAAREADFIAQAGRK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain