|
||||||
|
UniGene Name: sp_v3.0_unigene43797
Length: 149 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene43797
G |
|
Ace file of the UniGene sp_v3.0_unigene43797 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Gag-Pol polyprotein n=1 Tax=Lotus japonicus RepID=B8YLY7_LOTJA | - | - | 8.0e-14 | 75% |
| FL-Next | tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 74% |
| Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 4.085e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g07550; CHLREDRAFT_13035; F9K21.100; H0306F03.15; H0413E07.4; LOC_Os10g21080; LOC_Os10g34120; LOC_Os11g03830; LOC_Os11g05840; LOC_Os11g17390; LOC_Os12g31920; LOC_Os12g34770; LOC_Os12g35810; LYC_68t000004; OSIGBa0105O19.1; OSIGBa0146N20.7; OSJNAb0023M11 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | exonuclease activity | GO:0004527 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Pleckstrin homology domain | IPR001849 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
| Sma3 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR003583 | - | 0.0 | - |
| Sma3 | Putative 5-3 exonuclease | IPR004859 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | F-box associated interaction domain | IPR017451 | - | 0.0 | - |
| Sma3 | Peptidase A2A, retrovirus RVP subgroup | IPR018061 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9M5J7
Fln msg: Distance to subject end: 57 aas, your sequence is shorter than subject: 49 - 542
Fln protein:
E
Protein Length:
50
Fln nts:
G
Fln Alignment:
CL20285Contig1___YVDADYAGDLDKRRSTTGYVFTLAGGAISWMSKLQDTVALSTT
Q9M5J7_______________FVDADWVGDLDHIRSTSGYVFNLFGGAISWMSKIQALVALSTT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
