|
||||||
|
UniGene Name: sp_v3.0_unigene43644
Length: 244 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene43644
C |
|
Ace file of the UniGene sp_v3.0_unigene43644
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Zeaxanthin epoxidase, chloroplastic n=1 Tax=Populus trichocarpa RepID=B9H6G3_POPTR | - | - | 4.0e-30 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
| Sma3 | Zeaxanthin epoxidase | - | - | 6.251e-37 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:1.14.13.9- | - | 1.981e-21 | - |
| Source | Gene names |
|---|---|
| Sma3 | ABA2; At5g67030; AtABA1; CHLREDRAFT_53522; Cit-ZEP; CitZEP; CpABA1; GSVIVT00003739001; GSVIVT00019494001; H0818E04.7; LsZEP1; OSIGBa0152K17.16; OSJNBa0064H22.16; Os04g0448900; OsABA2; OsI_16086; OsJ_14973; PHYPADRAFT_186228; POPTRDRAFT_760467; POPTRDRAFT_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | zeaxanthin epoxidase [overall] activity | GO:0009540 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid biosynthetic process | GO:0009688 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Forkhead-associated (FHA) domain | IPR000253 | - | 0.0 | - |
| Sma3 | Monooxygenase, FAD-binding | IPR002938 | - | 0.0 | - |
| Sma3 | Aromatic-ring hydroxylase-like | IPR003042 | - | 0.0 | - |
| Sma3 | Fumarate reductase/succinate dehydrogenase flavoprotein, N-terminal | IPR003953 | - | 0.0 | - |
| Sma3 | EMSY N-terminal | IPR005491 | - | 0.0 | - |
| Sma3 | Immunoglobulin-like | IPR007110 | - | 0.0 | - |
| Sma3 | Zeaxanthin epoxidase | IPR017079 | - | 0.0 | - |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G67030.1 | ABA1, LOS6, NPQ2, ATABA1, ZEP, IBS3, ATZEP zeaxanthin epoxidase (ZEP) (ABA1) chr5:26753745-26757090 REVERSE LENGTH=667 | 5.0e-34 | 70% |
| RefSeq | Arabidopsis thaliana | NP_201504.2 | zeaxanthin epoxidase (ZEP) (ABA1) [Arabidopsis thaliana] | 5.0e-34 | 70% |
| RefSeq | Populus trichocarpa | XP_002307265.1 | predicted protein [Populus trichocarpa] | 1.0e-37 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PSJ1
Fln msg: Distance to subject end: 95 aas, your sequence is shorter than subject: 81 - 445
Fln protein:
Q
Protein Length:
82
Fln nts:
C
Fln Alignment:
CL18497Contig1___KVTVMLEDGRQCEGDILVGADGIWSKVREKLFGPKQAIYSQYTCYSGIVDFVPPEINTVAYRVYLGYKQYFVSSDVGSGK
C0PSJ1_______________KVTVRLEDGRHYEGDLLVGADGIWSKVRKQLFGPKEATYSGYTCYTGIADFVPPDIETVGYRVFLGHKQYFVSSDVGCGK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
