UniGene Name: sp_v3.0_unigene43520
Length: 224 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene43520
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP-binding cassette transporter n=1 Tax=Selaginella moellendorffii RepID=D8RL93_SELML | - | - | 2.0e-24 | 68% |
FL-Next | sp=ABC transporter G family member 36; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 65% |
Sma3 | ATP-binding cassette transporter, putative | - | - | 1.858e-39 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 2.17e-32 | - |
Sma3 | Polyamine-transporting ATPase. | EC:3.6.3.31 | - | 8.11e-06 | - |
Source | Gene names |
---|---|
Sma3 | ABC; ABC1; At1g15210; At1g15520; At1g59870; At1g66950; At2g36380; At2g37280; At3g53480; B1045F02.15; F1O11.1; F1O19.3; F23H11.19; F3G5.7; F4P12.180; F9L1.15; GSVIVT00016819001; GSVIVT00021655001; GSVIVT00022041001; GSVIVT00022062001; GSVIVT00022064001; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | cadmium ion transmembrane transporter activity | GO:0015086 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | defense response to fungus, incompatible interaction | GO:0009817 | Biological Process | 0.0 | - |
Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
Sma3 | lead ion transport | GO:0015692 | Biological Process | 0.0 | - |
Sma3 | negative regulation of defense response | GO:0031348 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein L11 | IPR000911 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G59870.1 | PEN3, PDR8, ATPDR8, ABCG36, ATABCG36 ABC-2 and Plant PDR ABC-type transporter family protein chr1:22034661-22039844 FORWARD LENGTH=1469 | 2.0e-26 | 65% |
RefSeq | Arabidopsis thaliana | NP_176196.1 | ABC transporter G family member 36 [Arabidopsis thaliana] | 2.0e-26 | 65% |
RefSeq | Populus trichocarpa | XP_002324840.1 | predicted protein [Populus trichocarpa] | 6.0e-27 | 60% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9XIE2
Fln msg: Distance to subject end: 855 aas, your sequence is shorter than subject: 74 - 1469
Fln protein:
V
Protein Length:
75
Fln nts:
T
Fln Alignment:
CL17084Contig1___YIFKTGQIVVVGILTMTMFFRTEMHQRNIDDGNLYMGALFFGLIHVMFNGFPELSMTVSRLPVFYKQRDFLFY
Q9XIE2_______________YVFKTVQIVIIAAITSTLFLRTEMNTRNEGDANLYIGALLFGMIINMFNGFAEMAMMVSRLPVFYKQRDLLFY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain