|
||||||
|
UniGene Name: sp_v3.0_unigene43335
Length: 241 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene43335
C |
|
Ace file of the UniGene sp_v3.0_unigene43335
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Chromatin remodelling complex ATPase chain isw-1, putative n=1 Tax=Ricinus communis RepID=B9S022_RICCO | - | - | 1.0e-29 | 78% |
| FL-Next | sp=CHD3-type chromatin-remodeling factor PICKLE; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 35% |
| Sma3 | SNF2 family DNA-dependent ATPase | - | - | 2.623e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | CHR1517; CHR1524; CHR3517; CHR921; F13G24.10; GSVIVT00019732001; OJ1136_D11.106; OJ1579_C03.20-1; OJ1579_C03.20-2; OSTLU_26262; Os07g0598300; Os07g0636200; OsI_26740; OsI_27014; OsJ_24993; OsJ_25277; Ot10g03090; PHYPADRAFT_107791; PHYPADRAFT_131093; POPTR |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | proton-transporting V-type ATPase, V1 domain | GO:0033180 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | hydrogen ion transporting ATP synthase activity, rotational mechanism | GO:0046933 | Molecular Function | 0.0 | - |
| Sma3 | proton-transporting ATPase activity, rotational mechanism | GO:0046961 | Molecular Function | 0.0 | - |
| Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | SNF2-related | IPR000330 | - | 0.0 | - |
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal | IPR000793 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site | IPR002464 | - | 0.0 | - |
| Sma3 | HNH endonuclease | IPR002711 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | HNH nuclease | IPR003615 | - | 0.0 | - |
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal | IPR004100 | - | 0.0 | - |
| Sma3 | ATPase, V1 complex, subunit A | IPR005725 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G48310.1 | CHR18, CHA18 chromatin remodeling factor18 chr1:17848620-17853731 REVERSE LENGTH=673 | 3.0e-32 | 62% |
| RefSeq | Arabidopsis thaliana | NP_175265.3 | chromatin remodeling factor18 [Arabidopsis thaliana] | 4.0e-32 | 62% |
| RefSeq | Populus trichocarpa | XP_002315473.1 | chromatin remodeling complex subunit, partial [Populus trichocarpa] | 6.0e-32 | 60% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9S775
Fln msg: Distance to subject end: 1037 aas, your sequence is shorter than subject: 80 - 1384
Fln protein:
D
Protein Length:
81
Fln nts:
C
Fln Alignment:
CL14844Contig1___DNMPDYMESQLLPFQRDGV---RFVLEHGGRALIADEMGLGKTLQAIAVASCL--KDAWPVLVITPSALRLQWALMIEQW
Q9S775_______________DHTPEFLKGLLHPYQLEGLNFLRFSWSKQTHVILADEMGLGKTIQSIALLASLFEENLIPHLVIAPLSTLRNWEREFATW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
