UniGene Name: sp_v3.0_unigene43144
Length: 128 nt
UniGene Fasta |
---|
>sp_v3.0_unigene43144
T |
Ace file of the UniGene sp_v3.0_unigene43144 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana] sp|Q9M0X9.1|4CLL7_ARATH RecName: Full=4-coumarate--CoA ligase-like 7; AltName: Full=4-coumarate--CoA ligase isoform 6; Short=At4CL6 emb|CAB81058.1| 4-coumarate--CoA ligase-like protein [Arabidopsis tha | - | - | 3.0e-07 | 77% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
Sma3 | Acyl:coa ligase | - | - | 8.69e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ligases, Forming carbon-sulfur bonds, Acid--thiol ligases. | EC:6.2.1.- | - | 1.704e-07 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Geraniol degradation | 00281 | 1.704e-07 | % | |
Sma3 | Tyrosine metabolism | 00350 | 1.704e-07 | % | |
Sma3 | Benzoate degradation | 00362 | 1.704e-07 | % | |
Sma3 | Fluorobenzoate degradation | 00364 | 1.704e-07 | % | |
Sma3 | alpha-Linolenic acid metabolism | 00592 | 1.704e-07 | % | |
Sma3 | Aminobenzoate degradation | 00627 | 1.704e-07 | % | |
Sma3 | Propanoate metabolism | 00640 | 1.704e-07 | % | |
Sma3 | Ethylbenzene degradation | 00642 | 1.704e-07 | % | |
Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 1.704e-07 | % | |
Sma3 | Limonene and pinene degradation | 00903 | 1.704e-07 | % | |
Sma3 | Tropane, piperidine and pyridine alkaloid biosynthesis | 00960 | 1.704e-07 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.704e-07 | % | |
Sma3 | Metabolic pathways | 01100 | 1.704e-07 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.704e-07 | % |
Source | Gene names |
---|---|
Sma3 | 4CLL1; 4CLL7; ACLL13; ACLL21; At4g05160; C17L7.80; GSVIVT00022179001; LOC_Os03g05780; Os03g0152400; OsI_10054; OsJ_09444; PHYPADRAFT_209184; POPTRDRAFT_803139; POPTRDRAFT_805626; RCOM_0351030; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | fatty-acyl-CoA synthase activity | GO:0004321 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | jasmonic acid biosynthetic process | GO:0009695 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
Sma3 | AMP-dependent synthetase/ligase | IPR000873 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G05160.1 | AMP-dependent synthetase and ligase family protein chr4:2664451-2666547 FORWARD LENGTH=544 | 2.0e-11 | 77% |
RefSeq | Arabidopsis thaliana | NP_192425.1 | 4-coumarate--CoA ligase-like 7 [Arabidopsis thaliana] | 3.0e-11 | 77% |
RefSeq | Populus trichocarpa | XP_002315339.1 | acyl:coa ligase [Populus trichocarpa] | 4.0e-11 | 71% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LNP4
Fln msg: Distance to subject end: 325 aas, your sequence is shorter than subject: 42 - 540
Fln protein:
V
Protein Length:
43
Fln nts:
T
Fln Alignment:
CL12840Contig1___QKSPPEVTIKQTDTAALLYSSGTTGTNKGAVLTHRNFMAA
B8LNP4_______________QKNPPEVIIEQTDTAALLYSSGTTGTNKGVVLTHRNFIAS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain