|
||||||
|
UniGene Name: sp_v3.0_unigene43045
Length: 232 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene43045
G |
|
Ace file of the UniGene sp_v3.0_unigene43045 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 5.667e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g29760; At3g09040; At3g49170; At4g13650; At5g08510; At5g09950; At5g15300; At5g39350; EMB2261; F18A5.40; F2K15.30; F8L15.21; F8M21_190; GSVIVT00000138001; GSVIVT00000282001; GSVIVT00000293001; GSVIVT00004379001; GSVIVT00005238001; GSVIVT00006516001; GSV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF221 | IPR003864 | - | 0.0 | - |
| Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | IPR011523 | - | 0.0 | - | |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G49170.1 | EMB2261 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:18226954-18229600 REVERSE LENGTH=850 | 4.0e-23 | 58% |
| RefSeq | Arabidopsis thaliana | NP_190486.2 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 5.0e-23 | 58% |
| RefSeq | Populus trichocarpa | XP_002321443.1 | predicted protein [Populus trichocarpa] | 5.0e-27 | 58% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Distance to subject end: 155 aas, atg_distance in limit (1-15): atg_distance = 15, W2: There is no M at the beginning, your sequence is shorter than subject: 77 - 246
Fln protein:
A
Protein Length:
78
Fln nts:
G
Fln Alignment:
CL11689Contig1___ACTVDILGRAGHLEEAMDFINKMPFKPDGTVWRTLLGACATYGNIELGIHAAKFLLELEPQEDVAYVLMSNIYAAAG
D5AAE0_______________ACMIDLLGRAGRLDEARDFMKTIPFAPDANVWGALLGACRMYGNIDLGKHAAECLFQLEPHNAAKYVLLSNIYAAAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
