UniGene Name: sp_v3.0_unigene42837
Length: 200 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene42837
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Kinesin, putative n=1 Tax=Ricinus communis RepID=B9SS38_RICCO | - | - | 6.0e-27 | 93% |
FL-Next | sp=Kinesin-like protein FLA10; Chlamydomonas reinhardtii (Chlamydomonas smithii). | - | - | 0.0 | 66% |
Sma3 | Kinesin-like protein | - | - | 3.137e-22 | - |
Source | Gene names |
---|---|
Sma3 | AT4g05190; AT4g14150; ATK1; ATK2; ATK3; ATK4; At1g63640; At1g72250; At1g73860; At2g47500; At3g10310; At3g23670; At3g43210; At3g44050; At3g63480; At3g63480/MAA21_110; At4g05190; At4g14150; At4g21270; At4g27180; At5g27000; At5g54670; AtNACK2; B1317D11.110; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nuclear chromosome, telomeric region | GO:0000784 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nuclear pore | GO:0005643 | Cellular Component | 0.0 | - |
Sma3 | minus-end kinesin complex | GO:0005872 | Cellular Component | 0.0 | - |
Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
Sma3 | microtubule associated complex | GO:0005875 | Cellular Component | 0.0 | - |
Sma3 | spindle microtubule | GO:0005876 | Cellular Component | 0.0 | - |
Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | microtubule motor activity | GO:0003777 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | microtubule binding | GO:0008017 | Molecular Function | 0.0 | - |
Sma3 | minus-end-directed microtubule motor activity | GO:0008569 | Molecular Function | 0.0 | - |
Sma3 | plus-end-directed microtubule motor activity | GO:0008574 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | telomere maintenance | GO:0000723 | Biological Process | 0.0 | - |
Sma3 | cytokinesis | GO:0000910 | Biological Process | 0.0 | - |
Sma3 | phragmoplast assembly | GO:0000914 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | protein import into nucleus | GO:0006606 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
Sma3 | male meiosis cytokinesis | GO:0007112 | Biological Process | 0.0 | - |
Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
Sma3 | anastral spindle assembly involved in male meiosis | GO:0009971 | Biological Process | 0.0 | - |
Sma3 | radial microtubular system formation | GO:0010245 | Biological Process | 0.0 | - |
Sma3 | actin filament polymerization | GO:0030041 | Biological Process | 0.0 | - |
Sma3 | spindle assembly | GO:0051225 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Sma3 | microgametogenesis | GO:0055046 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | FERM domain | IPR000299 | - | 0.0 | - |
Sma3 | MyTH4 domain | IPR000857 | - | 0.0 | - |
Sma3 | Bet v I domain | IPR000916 | - | 0.0 | - |
Sma3 | Calponin homology domain | IPR001715 | - | 0.0 | - |
Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
Sma3 | Basic-leucine zipper domain | IPR004827 | - | 0.0 | - |
Sma3 | ARP23 complex 20kDa subunit | IPR008384 | - | 0.0 | - |
Sma3 | Kinesin-related conserved domain | IPR010544 | - | 0.0 | - |
Sma3 | Telomere end binding protein | IPR011564 | - | 0.0 | - |
Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
Sma3 | Tetratricopeptide, MLP1/MLP2-like | IPR012929 | - | 0.0 | - |
Sma3 | FERM/acyl-CoA-binding protein, 3-helical bundle | IPR014352 | - | 0.0 | - |
Sma3 | FERM central domain | IPR019748 | - | 0.0 | - |
Sma3 | Band 4.1 domain | IPR019749 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G44050.1 | P-loop containing nucleoside triphosphate hydrolases superfamily protein chr3:15818738-15824792 FORWARD LENGTH=1263 | 1.0e-32 | 90% |
RefSeq | Arabidopsis thaliana | NP_189991.2 | kinesin motor protein-like protein [Arabidopsis thaliana] | 2.0e-32 | 90% |
RefSeq | Populus trichocarpa | XP_002328088.1 | predicted protein [Populus trichocarpa] | 7.0e-33 | 92% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P46869
Fln msg: Distance to subject end: 469 aas, your sequence is shorter than subject: 66 - 786
Fln protein:
L
Protein Length:
67
Fln nts:
C
Fln Alignment:
CL8668Contig1___LNLVDLAGSERQKSSGAEGERLKEASNINKSLSTLGLVIMNLVNIANGKAQHVPYRDSKLTFLLQD
P46869_______________LNLVDLAGSERQDKTGATGDRLKEGIKINLSLTALGNVISALV---DGKSGHIPYRDSKLTRLLQD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain