UniGene Name: sp_v3.0_unigene42735
Length: 212 nt
UniGene Fasta |
---|
>sp_v3.0_unigene42735
T |
Ace file of the UniGene sp_v3.0_unigene42735 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Set domain protein, putative n=1 Tax=Ricinus communis RepID=B9SQW4_RICCO | - | - | 2.0e-28 | 80% |
FL-Next | sp=Histone-lysine N-methyltransferase ASHR3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 72% |
Sma3 | Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20specific | - | - | 1.113e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Histone-lysine N-methyltransferase. | EC:2.1.1.43 | - | 5.56e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lysine degradation | 00310 | 5.56e-08 | % |
Source | Gene names |
---|---|
Sma3 | ASHH3; ASHR3; At2g44150; At4g30860; F6E13.28; F6I18.230; GSVIVT00013886001; GSVIVT00017128001; MICPUN_83006; OSJNBa0017N10.23-1; OSJNBa0092O08.1-1; Os02g0611300; Os09g0307800; OsI_08033; OsI_29393; OsI_30811; OsJ_07493; OsJ_27487; OsJ_28789; P0708B04.7; P |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome, centromeric region | GO:0000775 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | histone-lysine N-methyltransferase activity | GO:0018024 | Molecular Function | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | chromatin modification | GO:0016568 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SET domain | IPR001214 | - | 0.0 | - |
Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
Sma3 | Post-SET domain | IPR003616 | - | 0.0 | - |
Sma3 | AWS | IPR006560 | - | 0.0 | - |
Sma3 | Zinc finger, RING-like | IPR014857 | - | 0.0 | - |
Sma3 | IPR018069 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G30860.1 | ASHR3, SDG4 SET domain group 4 chr4:15024546-15027427 FORWARD LENGTH=497 | 3.0e-33 | 72% |
RefSeq | Arabidopsis thaliana | NP_567859.1 | histone-lysine N-methyltransferase ASHR3 [Arabidopsis thaliana] | 4.0e-33 | 72% |
RefSeq | Populus trichocarpa | XP_002325110.1 | SET domain protein [Populus trichocarpa] | 2.0e-34 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q949T8
Fln msg: Distance to subject end: 62 aas, your sequence is shorter than subject: 70 - 497
Fln protein:
E
Protein Length:
71
Fln nts:
T
Fln Alignment:
CL7614Contig1___EERLWEMKYRGVHNFYMCEIGKDFIIDATFKGNPSRFLNHSCDPNCKLEKWRVDGETRVGIFAAKDIMVG
Q949T8_______________EQRLWDMKHKGMKDFYMCEIQKDFTIDATFKGNASRFLNHSCNPNCVLEKWQVEGETRVGVFAARQIEAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain